| Features and Secondary Structure |
| | 1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280 . 290 . 300 . 310 . 320 . 330 . 340 . 350 |
| | MKNYTPVEIAASFFSAYGDPRSTSIDFSLDGKYFLSTHTDDAMRLVDVTEIKHKETIALNTVGLWRARFTQSSGVVCLASHRPCDGHLYLLNLNTAQLFASMSFVSDTVPVVPAIPNRPAYTAIAQSPCNDTIAAVFSAQGRLLLFHPLISGAVAASAENTFIGGGGAISFSPEGTQLLVSDDSCVRVYDYRKLFSGPLLTLQHNKMLPHCDSCGERRCIGMDIGSGGEELLLTYECGGVLLYDLRQNAVRGANFGIKGTIDGINSSCSVGARYVHPYLGHSPVVQLDSTSGKDTRLLVYHGSRAKSRWGSLRYEILCVADGDPIAMSVNPQYSMVATAAGGVTWWSFPPR |
| tmhmm (0) | --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| low complexity (0%) | --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| coiled-coils (0%) | --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| disordered (1%) | XX------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------X |
| psipred | ------------EE-------EEEEEE-----EEEEE----EEEEEE-----EEEEE------EEEEEEE----EEEEEE------EEEEEE----EEEEEE------EEEEEE------EEEEEE------EEEEEE--EEEEEEE------EEEE---------EEEEE-----EEEEE-----EEEEE-------EEEE-----EEEE-------EEEEEE-----EEEEEE----EEEEE-----EEEEE--------EEE--------EEEEEEEE-----EEEEE----EEEEEE----------EEEEEE------EEEEEE-----EEEEE---EEEE----- |
PSI-BLAST Sequence Hits (Top 20 by Identity) ALL DATA
 |
| TaxID |
Species |
Alignments |
PSI-Blast Data (alignment with lowest E value) |
| E value |
Query Span |
Sbjct Span |
Bit Score |
Identity |
HSP Length |
Accession |
Description |
| 679716 | Trypanosoma brucei gambiense DAL972 | 3 (0.13%) | 9E-72 | 1-351 | 1-351 | 277 | 99 | 351 | emb|CBH18720.1| | hypothetical protein, conserved [Trypanosoma brucei gambiens... |
| 5661 | Leishmania donovani | 2 (0.08%) | 6E-60 | 12-348 | 1-339 | 238 | 37 | 341 | ref|XP_001468069.1| | conserved hypothetical protein [Leishmania infantum JPCM5] r... |
| 420245 | Leishmania braziliensis MHOM/BR/75/M2904 | 3 (0.13%) | 1E-59 | 12-348 | 1-339 | 236 | 37 | 341 | ref|XP_001567754.1| | conserved hypothetical protein [Leishmania braziliensis MHOM... |
| 347515 | Leishmania major strain Friedlin | 5 (0.21%) | 1E-59 | 12-348 | 1-339 | 236 | 37 | 341 | ref|XP_001685708.1| | conserved hypothetical protein [Leishmania major strain Frie... |
| 246410 | Coccidioides immitis RS | 20 (0.85%) | 8E-87 | 1-346 | 21-352 | 327 | 22 | 354 | ref|XP_003067267.1| | WD domain, G-beta repeat containing protein [Coccidioides po... |
| 502779 | Paracoccidioides sp. 'lutzii' Pb01 | 1 (0.04%) | 5E-84 | 1-346 | 19-351 | 317 | 22 | 355 | ref|XP_002795795.1| | WD repeat-containing protein [Paracoccidioides sp. 'lutzii' ... |
| 339724 | Ajellomyces capsulatus NAm1 | 2 (0.08%) | 3E-81 | 1-346 | 19-351 | 308 | 22 | 355 | ref|XP_001542413.1| | WD repeat protein [Ajellomyces capsulatus NAm1] gb|EDN05981.... |
| 544711 | Ajellomyces capsulatus H88 | 1 (0.04%) | 1E-80 | 1-346 | 19-351 | 306 | 22 | 355 | gb|EER38865.1| | WD40 domain-containing protein [Ajellomyces capsulatus H143]... |
| 502780 | Paracoccidioides brasiliensis Pb18 | 1 (0.04%) | 2E-79 | 12-346 | 22-342 | 302 | 22 | 343 | gb|EEH49567.1| | WD repeat-containing protein [Paracoccidioides brasiliensis ... |
| 336963 | Uncinocarpus reesii 1704 | 1 (0.04%) | 6E-86 | 1-346 | 22-353 | 324 | 21 | 354 | ref|XP_002584280.1| | hypothetical protein UREG_04969 [Uncinocarpus reesii 1704] g... |
| 447095 | Ajellomyces dermatitidis ATCC 26199 | 1 (0.04%) | 2E-83 | 1-346 | 20-352 | 315 | 21 | 355 | gb|EQL37693.1| | hypothetical protein BDFG_00749 [Ajellomyces dermatitidis AT... |
| 858893 | Exophiala dermatitidis NIH/UT8656 | 1 (0.04%) | 3E-75 | 1-346 | 13-343 | 288 | 21 | 356 | gb|EHY52662.1| | hypothetical protein HMPREF1120_00871 [Exophiala dermatitidi... |
| 482561 | Paracoccidioides brasiliensis Pb03 | 1 (0.04%) | 1E-65 | 1-346 | 19-326 | 256 | 21 | 355 | gb|EEH22773.1| | WD repeat-containing protein [Paracoccidioides brasiliensis ... |
| 436907 | Vanderwaltozyma polyspora DSM 70294 | 1 (0.04%) | 1E-63 | 8-350 | 14-326 | 250 | 21 | 347 | ref|XP_001643677.1| | hypothetical protein Kpol_1057p7 [Vanderwaltozyma polyspora ... |
| 451804 | Aspergillus fumigatus A1163 | 3 (0.13%) | 1E-84 | 1-346 | 27-357 | 319 | 20 | 354 | gb|EDP51974.1| | WD repeat protein [Aspergillus fumigatus A1163] |
| 5061 | Aspergillus niger | 8 (0.34%) | 1E-83 | 1-346 | 28-359 | 316 | 20 | 355 | ref|XP_001401308.1| | WD repeat protein [Aspergillus niger CBS 513.88] emb|CAK4667... |
| 344612 | Aspergillus clavatus NRRL 1 | 9 (0.38%) | 1E-83 | 1-346 | 30-360 | 316 | 20 | 354 | ref|XP_001274527.1| | WD repeat protein [Aspergillus clavatus NRRL 1] gb|EAW13101.... |
| 1033177 | Aspergillus kawachii IFO 4308 | 1 (0.04%) | 2E-83 | 1-346 | 28-359 | 316 | 20 | 355 | gb|EHA28051.1| | WD-40 repeat protein [Aspergillus niger ATCC 1015] dbj|GAA91... |
| 1160506 | Aspergillus oryzae 3.042 | 2 (0.08%) | 2E-81 | 1-346 | 35-365 | 309 | 20 | 355 | ref|XP_001824076.1| | WD repeat protein [Aspergillus oryzae RIB40] ref|XP_00238115... |
| 559298 | Ajellomyces dermatitidis SLH14081 | 1 (0.04%) | 6E-81 | 1-346 | 20-346 | 307 | 20 | 355 | ref|XP_002621190.1| | WD repeat protein [Ajellomyces dermatitidis SLH14081] gb|EEQ... |
