| Features and Secondary Structure |
| | 1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280 . 290 . 300 . 310 . 320 . 330 |
| | MSRDTISIHFVNAALSGVKRLGMDVDTLLSHVGIEAELLHQPKARISPEQYTRFIKMLWMVTQDEHVGFDKQQRRLGTFAIMCQLIIHAKTLGDALELSSQFYKLFGDEWSVTLERDKHEARLVPLIPNAMDPDHFITESMLMIWHGLASWLIERRLPLERVHFSYPRPAHADEYDALFFAPVMQFDMPRTEITFAADYLDLPIRQNEETLEEFLKAAPAQLLVKFKNTNSLTSRIRDVLKSQIGEEMPTLNDVASMLYLSPQTLRRRLAAEGKSYQGVKDALRRDAAIHLLLNPDLTLEDVAQQVGFSETSTFHRAFKKWTGVTPGLYRQLHGYH |
| tmhmm (0) | ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ |
| low complexity (0%) | ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ |
| coiled-coils (0%) | ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ |
| disordered (4%) | XXX----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXXXX |
| psipred | -----HHHHHHHHHHHHHHH----HHHHHHHH---HHHHH-------HHHHHHHHHHHHHHH------HHHH----HHHHHHHHHHH----HHHHHHHHHHHHHHH----EEEEEEE--EEEEEEE------HHHHHHHHHHHHHHHHHHHH-------HHHH--------HHHHHHH----EEE--HHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHH----HHHHHHHHHH---HHHHHHHHHH----HHHHHHHHHHHHHHHHHH-----HHHHHHHH----HHHHHHHHHHHH---HHHHHHH---- |
PSI-BLAST Sequence Hits (Top 20 by Identity) ALL DATA
|
| TaxID |
Species |
Alignments |
PSI-Blast Data (alignment with lowest E value) |
| E value |
Query Span |
Sbjct Span |
Bit Score |
Identity |
HSP Length |
Accession |
Description |
| 1144662 | Acinetobacter sp. CIP 101966 | 2 (0.05%) | 1E-100 | 1-336 | 1-336 | 372 | 100 | 336 | ref|WP_005169495.1| | hypothetical protein [Acinetobacter] gb|ENW87208.1| hypothet... |
| 1217668 | Acinetobacter lwoffii NIPH 478 | 2 (0.05%) | 1E-100 | 1-336 | 1-336 | 370 | 100 | 336 | ref|WP_005106131.1| | hypothetical protein [Acinetobacter lwoffii] gb|ENW31971.1| ... |
| 575588 | Acinetobacter lwoffii SH145 | 4 (0.1%) | 1E-101 | 1-336 | 11-346 | 376 | 99 | 336 | ref|WP_004281704.1| | AraC family transcriptional regulator [Acinetobacter lwoffii... |
| 1144673 | Acinetobacter sp. CIP 64.7 | 3 (0.07%) | 1E-100 | 1-336 | 1-336 | 372 | 99 | 336 | ref|WP_004645946.1| | hypothetical protein [Acinetobacter] gb|ENU17637.1| hypothet... |
| 981327 | Acinetobacter lwoffii NCTC 5866 = CIP 64.10 | 2 (0.05%) | 1E-100 | 1-336 | 1-336 | 371 | 99 | 336 | ref|WP_005098008.1| | hypothetical protein [Acinetobacter lwoffii] gb|ENW23101.1| ... |
| 1310605 | Acinetobacter baumannii 348935 | 1 (0.03%) | 1E-100 | 1-336 | 1-336 | 370 | 99 | 336 | ref|WP_004785199.1| | hypothetical protein [Acinetobacter] gb|ENU98137.1| hypothet... |
| 1217660 | Acinetobacter indicus ANC 4215 | 2 (0.05%) | 1E-99 | 1-336 | 13-348 | 369 | 97 | 336 | ref|WP_005175790.1| | hypothetical protein [Acinetobacter] gb|ENW91116.1| hypothet... |
| 1144661 | Acinetobacter sp. CIP 101934 | 1 (0.03%) | 1E-99 | 1-336 | 1-336 | 369 | 97 | 336 | ref|WP_004814497.1| | AraC family transcriptional regulator [Acinetobacter] gb|EIM... |
| 1147131 | Acinetobacter nosocomialis 28F | 1 (0.03%) | 1E-102 | 1-336 | 50-385 | 377 | 96 | 336 | ref|WP_006580334.1| | AraC family transcriptional regulator [Acinetobacter] gb|ERL... |
| 1149135 | Acinetobacter baumannii 107m | 1 (0.03%) | 1E-102 | 1-336 | 50-385 | 377 | 96 | 336 | ref|YP_001712600.1| | AraC family transcriptional regulator [Acinetobacter baumann... |
| 470 | Acinetobacter baumannii | 24 (0.6%) | 1E-102 | 1-336 | 50-385 | 377 | 96 | 336 | ref|WP_001277859.1| | AraC family transcriptional regulator [Acinetobacter baumann... |
| 575585 | Acinetobacter calcoaceticus RUH2202 | 18 (0.45%) | 1E-102 | 1-336 | 50-385 | 377 | 96 | 336 | ref|WP_003655243.1| | AraC family transcriptional regulator [Acinetobacter calcoac... |
| 509170 | Acinetobacter baumannii SDF | 5 (0.12%) | 1E-101 | 1-336 | 50-385 | 375 | 96 | 336 | ref|YP_001706220.1| | AraC family transcriptional regulator [Acinetobacter baumann... |
| 1147132 | Acinetobacter pittii 42F | 2 (0.05%) | 1E-101 | 1-336 | 50-385 | 375 | 96 | 336 | ref|YP_004996580.1| | two-component response regulator [Acinetobacter calcoaceticu... |
| 48296 | Acinetobacter pittii | 2 (0.05%) | 1E-101 | 1-336 | 50-385 | 374 | 96 | 336 | ref|WP_017400277.1| | AraC family transcriptional regulator [Acinetobacter pittii] |
| 981331 | Acinetobacter calcoaceticus DSM 30006 = CIP 81.8 | 4 (0.1%) | 1E-100 | 1-336 | 1-336 | 370 | 96 | 336 | ref|WP_004638954.1| | hypothetical protein [Acinetobacter calcoaceticus] gb|ENU111... |
| 1310914 | Acinetobacter baumannii 25977_10 | 3 (0.07%) | 1E-100 | 1-336 | 1-336 | 370 | 96 | 336 | ref|WP_002051267.1| | AraC family transcriptional regulator [Acinetobacter] gb|EKF... |
| 1311006 | Acinetobacter baumannii 25681_2 | 8 (0.2%) | 1E-100 | 1-336 | 1-336 | 370 | 96 | 336 | ref|YP_001085859.1| | AraC family transcriptional regulator [Acinetobacter baumann... |
| 1120929 | Acinetobacter towneri DSM 14962 = CIP 107472 | 2 (0.05%) | 1E-99 | 1-336 | 1-336 | 369 | 96 | 336 | ref|WP_004972448.1| | hypothetical protein [Acinetobacter towneri] gb|ENV70343.1| ... |
| 1310783 | Acinetobacter baumannii 214216 | 3 (0.07%) | 2E-99 | 1-336 | 1-336 | 369 | 96 | 336 | gb|EXR83073.1| | bacterial regulatory helix-turn-helix s, AraC family protein... |