old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100
	MVTEIRSLKQLEEIFSAKKNVIVDFWAAWCGPCKLTSPEFQKAADEFSDAQFVKVNVDDHTDIAAAYNITSLPTIVVFENGVEKKRAIGFMPKTKIIDLFNN
tmhmm (0)	------------------------------------------------------------------------------------------------------
low complexity (0%)	------------------------------------------------------------------------------------------------------
coiled-coils (0%)	------------------------------------------------------------------------------------------------------
disordered (2%)	X----------------------------------------------------------------------------------------------------X
psipred	-EEEE--HHHHHHHH----EEEEEEE----HHHHHHHHHHHHHHHH----EEEEEE----HHHHHH-------EEEEEE--EEEEEE-----HHHHHHHH--

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    44	    0.236
  max. Y    44	    0.190
  max. S    43	    0.278
  mean S     1-43   0.161
       D     1-43   0.178    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.178 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-102	alignment	4cw9B_201	1-104	0.9649	--

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
368408	Thermofilum pendens Hrk 5	2 (0.05%)	2E-25	11-92	39-121	120	45	83	ref|YP_920530.1|	thioredoxin [Thermofilum pendens Hrk 5] ref|WP_011752792.1| ...
1094508	Thermoanaerobacterium saccharolyticum JW/SL-YS485	2 (0.05%)	1E-32	3-97	4-99	144	44	96	ref|YP_006392239.1|	thioredoxin [Thermoanaerobacterium saccharolyticum JW/SL-YS4...
858215	Thermoanaerobacterium xylanolyticum LX-11	2 (0.05%)	5E-33	3-97	4-99	145	43	96	ref|YP_004470832.1|	thioredoxin [Thermoanaerobacterium xylanolyticum LX-11] ref|...
1229781	Brevibacterium casei S18	1 (0.03%)	2E-32	1-100	1-101	143	43	101	ref|WP_009376880.1|	thioredoxin [Brevibacterium casei] gb|EKU48451.1| thioredoxi...
748727	Clostridium ljungdahlii DSM 13528	1 (0.03%)	4E-30	1-101	1-102	136	43	102	ref|YP_003782176.1|	thioredoxin [Clostridium ljungdahlii DSM 13528] ref|YP_00869...
498761	Heliobacterium modesticaldum Ice1	1 (0.03%)	8E-33	2-101	6-106	145	42	101	ref|YP_001680420.1|	thioredoxin [Heliobacterium modesticaldum Ice1] ref|WP_01228...
883109	Eubacterium infirmum F0142	1 (0.03%)	3E-32	2-101	3-102	143	42	100	ref|WP_006000117.1|	thiol-disulfide isomerase [[Eubacterium] infirmum] gb|EHO859...
698948	Thermoanaerobacterium thermosaccharolyticum M0795	2 (0.05%)	3E-32	3-97	4-99	143	42	96	ref|YP_003852208.1|	thioredoxin [Thermoanaerobacterium thermosaccharolyticum DSM...
469378	Cryptobacterium curtum DSM 15641	1 (0.03%)	4E-31	1-101	1-102	139	42	102	ref|YP_003151275.1|	thioredoxin [Cryptobacterium curtum DSM 15641] ref|WP_012803...
401526	Thermosinus carboxydivorans Nor1	2 (0.05%)	1E-30	2-102	3-105	138	42	103	ref|WP_007288865.1|	thioredoxin [Thermosinus carboxydivorans] gb|EAX48211.1| thi...
1129368	Spiroplasma melliferum IPMB4A	1 (0.03%)	8E-27	1-98	1-99	125	42	99	ref|WP_004027799.1|	thioredoxin [Spiroplasma melliferum] emb|CAK99640.1| putativ...
656519	Halanaerobium hydrogeniformans	1 (0.03%)	3E-32	2-100	4-103	143	41	100	ref|YP_003994206.1|	thioredoxin [Halanaerobium hydrogeniformans] ref|WP_01340495...
411903	Collinsella aerofaciens ATCC 25986	1 (0.03%)	1E-31	7-101	12-107	141	41	96	ref|WP_006235224.1|	thioredoxin [Collinsella aerofaciens] gb|EBA39701.1| thiored...
1321778	Clostridiales bacterium oral taxon 876 str. F0540	1 (0.03%)	7E-31	1-101	1-101	138	41	102	ref|WP_021657809.1|	thioredoxin [Clostridiales bacterium oral taxon 876] gb|ERI8...
1050716	candidate division YNPFFA	1 (0.03%)	2E-29	3-101	7-106	134	41	100	ref|WP_018194386.1|	hypothetical protein [candidate division YNPFFA]
1125702	Treponema vincentii F0403	1 (0.03%)	3E-29	1-100	1-101	133	41	101	ref|WP_006190066.1|	thioredoxin [Treponema vincentii] gb|EEV19315.1| thioredoxin...
1097677	Clavibacter michiganensis subsp. nebraskensis NCPPB 2581	2 (0.05%)	2E-28	4-98	6-100	130	41	95	ref|YP_001223713.1|	putative thioredoxin [Clavibacter michiganensis subsp. michi...
436907	Vanderwaltozyma polyspora DSM 70294	3 (0.07%)	2E-27	1-102	1-102	127	41	103	ref|XP_001645789.1|	hypothetical protein Kpol_1010p47 [Vanderwaltozyma polyspora...
861360	Arthrobacter arilaitensis Re117	1 (0.03%)	5E-26	2-98	4-101	123	41	98	ref|YP_003918586.1|	thioredoxin [Arthrobacter arilaitensis Re117] ref|WP_0133507...
583355	Coraliomargarita akajimensis DSM 45221	1 (0.03%)	6E-26	20-100	23-104	122	41	82	ref|YP_003548129.1|	thioredoxin [Coraliomargarita akajimensis DSM 45221] ref|WP_...