old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280 .
	MLVNFKLMLQKAKLGKYAIPHININNYEWAKAVLTAANQANSPIIVSVSEGALKYMSGYSVVIPLVKGLIESLSVKVPVTLHLDHGSYDACIQALQAGFSSVMFDGSHLPFEENFNKSKKLIEIAQKTNASVELEVGTIGGEEDGVIGQGELANVDECKQIASLKPDALAAGIGNIHGIYPKNWKGLNFPLIETISKITNLPLVLHGGSGILENDVKKAISLGICKLNINTECQLAFAHEIRKYIESNKDLDLNKKGYDPRKLLKEPTQAIVDTCLEKIDLCGSRNKA
tmhmm (0)	------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)	------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (1%)	----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XX
psipred	----HHHHHHHHHH---EEEEEEE--HHHHHHHHHHHHHH---EEEEE-HHHHH----HHHHHHHHHHHHHH------EEEE------HHHHHHHH----EEEE-HHHHHHHHHHHHHHHHHHH------EEEEEEEEE---------------HHHHHHHHHH--HHHHHHH---------------HHHHHHHHHH----EEE-------HHHHHHHHH---EEEEE--HHHHHHHHHHHHHHHH------------HHHHHHHHHHHHHHHHHHHHHHH------

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    33	    0.160
  max. Y    12	    0.219
  max. S     8	    0.577
  mean S     1-11   0.485
       D     1-11   0.323    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.323 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-288	alignment	3q94A_201	1-285	0.9693	LYASE

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
662945	Mycoplasma genitalium M6320	1 (0.03%)	1E-107	1-288	1-288	395	100	288	ref|YP_006600523.1|	fructose-1,6-bisphosphate aldolase [Mycoplasma genitalium M6...
663918	Mycoplasma genitalium M2321	1 (0.03%)	1E-107	1-288	1-288	395	100	288	ref|NP_072683.1|	fructose-1,6-bisphosphate aldolase, class II [Mycoplasma gen...
662947	Mycoplasma genitalium M2288	1 (0.03%)	1E-107	1-288	1-288	395	99	288	ref|YP_006601032.1|	fructose-1,6-bisphosphate aldolase [Mycoplasma genitalium M2...
662946	Mycoplasma genitalium M6282	1 (0.03%)	1E-104	8-288	1-281	384	99	281	ref|YP_006600036.1|	fructose-1,6-bisphosphate aldolase [Mycoplasma genitalium M6...
1112856	Mycoplasma pneumoniae 309	1 (0.03%)	1E-108	1-288	1-288	396	78	288	ref|YP_005175257.1|	fructose-1,6-bisphosphate aldolase [Mycoplasma pneumoniae 30...
1238993	Mycoplasma pneumoniae M129-B7	1 (0.03%)	1E-107	1-288	1-288	395	78	288	ref|NP_109713.1|	fructose-bisphosphate aldolase [Mycoplasma pneumoniae M129] ...
710128	Mycoplasma gallisepticum str. R(high)	1 (0.03%)	1E-106	2-288	4-290	392	64	287	ref|NP_853443.2|	fructose-bisphosphate aldolase [Mycoplasma gallisepticum str...
1159204	Mycoplasma gallisepticum NC08_2008.031-4-3P	1 (0.03%)	1E-106	2-288	4-290	392	64	287	ref|YP_006581558.1|	Fructose-bisphosphate aldolase [Mycoplasma gallisepticum VA9...
1006581	Mycoplasma gallisepticum S6	1 (0.03%)	1E-106	2-288	4-290	392	64	287	ref|YP_008894583.1|	fructose-bisphosphate aldolase [Mycoplasma gallisepticum S6]...
708616	Mycoplasma gallisepticum str. F	1 (0.03%)	1E-105	2-288	4-290	389	64	287	ref|YP_005880977.1|	Fructose-bisphosphate aldolase [Mycoplasma gallisepticum str...
2096	Mycoplasma gallisepticum	1 (0.03%)	1E-107	2-288	4-290	393	63	287	gb|AAL91129.1|	fructose-bisphosphate aldolase [Mycoplasma gallisepticum]
1048830	Mycoplasma iowae 695	1 (0.03%)	1E-107	2-288	8-294	395	62	287	ref|WP_004024626.1|	fructose-bisphosphate aldolase [Mycoplasma iowae] gb|EGZ3167...
861454	Lachnospiraceae bacterium oral taxon 082 str. F0431	1 (0.03%)	1E-114	1-288	1-287	419	60	289	ref|WP_009445416.1|	fructose-bisphosphate aldolase [Lachnospiraceae bacterium or...
556261	Clostridium sp. D5	5 (0.16%)	1E-113	1-288	6-292	414	60	289	ref|WP_009001762.1|	fructose-bisphosphate aldolase [Clostridium sp. D5] gb|EGB94...
658655	Lachnospiraceae bacterium 1_4_56FAA	1 (0.03%)	1E-113	1-288	1-287	412	60	289	ref|WP_009266656.1|	fructose-bisphosphate aldolase [Lachnospiraceae bacterium 1_...
1262769	Clostridium sp. CAG:1013	1 (0.03%)	1E-112	1-288	1-287	411	60	289	ref|WP_016406106.1|	fructose-1 6-bisphosphate aldolase class II [Clostridium sp....
1226325	Clostridium sp. KLE 1755	1 (0.03%)	1E-116	1-288	52-338	425	59	289	ref|WP_021634660.1|	fructose-1,6-bisphosphate aldolase, class II [Clostridium sp...
1073376	Ruminococcus lactaris CC59_002D	1 (0.03%)	1E-114	1-288	1-287	419	59	289	ref|WP_023921755.1|	fructose-1,6-bisphosphate aldolase, class II [Ruminococcus l...
657313	Ruminococcus torques L2-14	4 (0.13%)	1E-114	1-288	1-287	417	59	289	ref|YP_007786565.1|	fructose-1,6-bisphosphate aldolase, class II, various bacter...
471875	Ruminococcus lactaris ATCC 29176	1 (0.03%)	1E-114	1-288	9-295	417	59	289	ref|WP_005611011.1|	fructose-bisphosphate aldolase [Ruminococcus lactaris] gb|ED...