old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280 . 290 . 300 . 310 . 320 . 330 . 340 . 350 . 360 . 370 . 380 . 390
	MLNNILQFLKERELYSQANFETELDNHLKEKKNNFYVGFDPTANSLHIGNYVLIHIAKLLKDMGHTPHIVLGSATALIGDPTGRIELRKILEEKEIVKNTKTIKKQIKQFLGDVIIHENKVWLEKLNYIEVIRELGAFFSVNKMLSTDAFSARWEKGLTLMELNYMILQAYDFYYLHKNHNVTLQIGGSDQWANILAGANLIKRKNNASVFGLTANLLVKANGEKMGKTSSGALWLDENKTSVFDFYQYWINLDDQSLKKTFLMLTMLDKKVIDELCNLKGPKIKQTKQMLAFLITELIHGTKKAKEAQQRSELIFSNQPDLDIKLVKTSTNLIDYLVETKFIKSKSEARRLISQKGLTINNKHVLDLNQIIEWKEELQIIRKGKKSFLTIKTVNS
tmhmm (0)	------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (6%)	-----------------------------------------------------------------------------------XXXXXXXXXXXXX---XXXXXXXXXX-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (5%)	XX-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXX----------------------------------------------------------XXXXXXXXXX-------------------------------------------X
psipred	--HHHHHHHHH---HHH---HHHHHHHHH----EEEEEE------HHHHHHHHHHHHHHHHH---EEEEEEEE-EEEE--------------HHHHHHHHHHHHHHHHHH----EEE---HHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHH----HHHHHHHHHH----EEEEE---HHHHHHHHHHHHHHHH-----EEEEE--HHH---------------------HHHHHHHHH----HHHHHHHHHHH----HHHHHHHHH-----HHHHHHHHHHHHHHHH--HHHHHHHHHHHHHH-------EEEE------HHHHHHH------HHHHHHHHH--EEEE--EEE-----EE-----EEEEEE---EEEEEEEE--

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    21	    0.109
  max. Y    21	    0.137
  max. S    16	    0.216
  mean S     1-20   0.163
       D     1-20   0.147    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.147 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-396	alignment	1h3eA_103	1-427	0.9484	LIGASE

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
2097	Mycoplasma genitalium	1 (0.03%)	1E-101	64-396	2-334	376	100	333	ref|WP_009885578.1|	tRNA synthetase RNA-binding protein [Mycoplasma genitalium]
1112856	Mycoplasma pneumoniae 309	1 (0.03%)	1E-126	1-394	1-395	456	62	395	ref|YP_005175920.1|	tyrosyl tRNA synthetase [Mycoplasma pneumoniae 309] ref|YP_0...
212717	Clostridium tetani E88	1 (0.03%)	1E-154	1-393	6-411	550	44	406	ref|NP_782975.1|	tyrosyl-tRNA synthetase [Clostridium tetani E88] ref|WP_0111...
583346	Clostridium kluyveri NBRC 12016	2 (0.05%)	1E-153	2-391	1-403	548	43	403	ref|YP_001394159.1|	tyrosyl-tRNA synthetase [Clostridium kluyveri DSM 555] ref|Y...
1231072	Clostridium tetani 12124569	1 (0.03%)	1E-153	1-393	1-406	548	43	406	ref|YP_008774683.1|	tyrosyl-tRNA synthetase [Clostridium tetani 12124569] ref|WP...
857293	Caloramator australicus RC3	1 (0.03%)	1E-141	4-393	2-404	507	43	403	ref|WP_008908937.1|	tyrosyl-tRNA synthetase [Caloramator australicus] emb|CCJ336...
1094508	Thermoanaerobacterium saccharolyticum JW/SL-YS485	1 (0.03%)	1E-148	4-394	2-405	530	42	404	ref|YP_006390663.1|	tyrosyl-tRNA synthetase [Thermoanaerobacterium saccharolytic...
858215	Thermoanaerobacterium xylanolyticum LX-11	1 (0.03%)	1E-148	4-394	2-405	530	42	404	ref|YP_004471614.1|	tyrosyl-tRNA synthetase [Thermoanaerobacterium xylanolyticum...
941824	Thermobrachium celere DSM 8682	1 (0.03%)	1E-147	4-393	2-404	529	42	403	ref|WP_018662432.1|	Tyrosyl-tRNA synthetase [Thermobrachium celere] emb|CDF58394...
1192197	Pelosinus fermentans JBW45	1 (0.03%)	1E-144	5-394	3-405	519	42	403	ref|WP_007961505.1|	tyrosyl-tRNA synthetase [Pelosinus fermentans] gb|EIW46421.1...
999423	Selenomonas sp. F0473	1 (0.03%)	1E-140	2-376	1-381	506	42	381	ref|WP_009727952.1|	tyrosine-tRNA ligase [Selenomonas sp. F0473] gb|EKU71658.1| ...
1321781	Mitsuokella sp. oral taxon 131 str. W9106	1 (0.03%)	1E-140	1-391	25-425	505	42	401	ref|WP_021770748.1|	tyrosine--tRNA ligase [Mitsuokella sp. oral taxon 131] gb|ER...
500635	Mitsuokella multacida DSM 20544	1 (0.03%)	1E-136	2-376	1-382	492	42	382	ref|WP_005839670.1|	tyrosyl-tRNA synthetase [Mitsuokella multacida] gb|EEX69499....
6945	Ixodes scapularis	4 (0.11%)	9E-67	4-204	3-211	260	42	209	ref|XP_002408493.1|	tyrosyl-tRNA synthetase, putative [Ixodes scapularis] gb|EEC...
498214	Clostridium botulinum A3 str. Loch Maree	2 (0.05%)	1E-156	2-393	1-406	557	41	406	ref|YP_001788639.1|	tyrosyl-tRNA synthetase [Clostridium botulinum A3 str. Loch ...
515621	Clostridium botulinum Ba4 str. 657	2 (0.05%)	1E-155	2-393	1-406	554	41	406	ref|YP_002864315.1|	tyrosyl-tRNA synthetase [Clostridium botulinum Ba4 str. 657]...
1138384	Clostridium thermocellum AD2	2 (0.05%)	1E-153	2-394	1-408	548	41	408	ref|YP_001037151.1|	tyrosyl-tRNA synthetase [Clostridium thermocellum ATCC 27405...
1232188	Clostridium botulinum CFSAN001628	2 (0.05%)	1E-152	2-393	1-406	545	41	406	ref|YP_001782947.1|	tyrosyl-tRNA synthetase [Clostridium botulinum B1 str. Okra]...
1248417	Clostridium botulinum Af84	2 (0.05%)	1E-152	2-393	1-406	545	41	406	ref|YP_001392669.1|	tyrosyl-tRNA synthetase [Clostridium botulinum F str. Langel...
441771	Clostridium botulinum A str. Hall	2 (0.05%)	1E-152	2-393	1-406	544	41	406	ref|YP_001255807.1|	tyrosyl-tRNA synthetase [Clostridium botulinum A str. ATCC 3...