| Features and Secondary Structure |
| | 1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . |
| | MPTYKLIVGLGNLGKKYEKTRHNAGFMVLDRLASLFHLNFDKTNKLGDYLFIKEKAAILAKPATFMNNSGLFVKWLQDHFQIPLANIMIVHDEIAFDLGVIRLKMQGSANNHNGIKSVIRHLDTEQFNRLRFGIKSQNTSNILHEQVMSEFQNSELTKLEVAITKSVELLKRYIEGEELQRLMEYYHHG |
| tmhmm (0) | --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| low complexity (0%) | --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| coiled-coils (0%) | --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| disordered (5%) | X---------------------------------------------------------------------------------------------------------XXXXX---------------------------------------------------------------------------XXX |
| psipred | ----EEEEE-----HHH--------HHHHHHHHHH------EE--EEEEEE---EEEEE----HHHH---HHHHHHHHHH-----EEEEEE--------EEEEE----------HHHHHHH-----EEEEEEE-------------------HHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHH--- |
PSI-BLAST Sequence Hits (Top 20 by Identity) ALL DATA
|
| TaxID |
Species |
Alignments |
PSI-Blast Data (alignment with lowest E value) |
| E value |
Query Span |
Sbjct Span |
Bit Score |
Identity |
HSP Length |
Accession |
Description |
| 662947 | Mycoplasma genitalium M2288 | 1 (0.04%) | 3E-58 | 1-189 | 1-189 | 230 | 100 | 189 | ref|NP_072745.1| | peptidyl-tRNA hydrolase [Mycoplasma genitalium G37] ref|YP_0... |
| 1121865 | Enterococcus columbae DSM 7374 = ATCC 51263 | 1 (0.04%) | 1E-76 | 4-187 | 1-186 | 291 | 41 | 186 | ref|WP_016183974.1| | peptidyl-tRNA hydrolase [Enterococcus columbae] gb|EOT39567.... |
| 712961 | Lactobacillus salivarius CECT 5713 | 1 (0.04%) | 7E-74 | 4-187 | 1-185 | 282 | 41 | 186 | ref|YP_005864186.1| | Peptidyl-tRNA hydrolase (PTH) [Lactobacillus salivarius CECT... |
| 748449 | Halobacteroides halobius DSM 5150 | 1 (0.04%) | 2E-73 | 4-187 | 1-185 | 280 | 41 | 186 | ref|YP_007314214.1| | peptidyl-tRNA hydrolase [Halobacteroides halobius DSM 5150] ... |
| 1108963 | Lactobacillus salivarius SMXD51 | 1 (0.04%) | 2E-73 | 4-187 | 1-185 | 280 | 41 | 186 | ref|WP_003703198.1| | peptidyl-tRNA hydrolase [Lactobacillus salivarius] gb|EFK797... |
| 1041521 | Lactobacillus salivarius GJ-24 | 1 (0.04%) | 4E-73 | 3-187 | 15-200 | 279 | 41 | 187 | ref|WP_004564204.1| | peptidyl-tRNA hydrolase [Lactobacillus salivarius] gb|EGM521... |
| 525364 | Lactobacillus salivarius ATCC 11741 | 1 (0.04%) | 4E-73 | 3-187 | 15-200 | 279 | 41 | 187 | ref|WP_003701374.1| | peptidyl-tRNA hydrolase [Lactobacillus salivarius] gb|EEJ741... |
| 46469 | Orenia marismortui | 1 (0.04%) | 8E-73 | 4-187 | 1-184 | 278 | 41 | 186 | ref|WP_018248276.1| | hypothetical protein [Orenia marismortui] |
| 1273133 | Lactobacillus salivarius cp400 | 1 (0.04%) | 2E-72 | 4-187 | 1-185 | 277 | 41 | 186 | emb|CDK34955.1| | Peptidyl-tRNA hydrolase (PTH) [Lactobacillus salivarius cp40... |
| 526975 | Bacillus cereus BDRD-ST26 | 1 (0.04%) | 3E-62 | 2-139 | 20-159 | 243 | 41 | 140 | ref|WP_002026814.1| | peptidyl-tRNA hydrolase [Bacillus cereus] gb|EEL02769.1| Pep... |
| 1046596 | Lactobacillus mali KCTC 3596 = DSM 20444 | 1 (0.04%) | 8E-75 | 4-188 | 1-186 | 285 | 40 | 187 | ref|WP_003687302.1| | peptidyl-tRNA hydrolase [Lactobacillus mali] gb|EJF01983.1| ... |
| 655812 | Aerococcus viridans ATCC 11563 | 1 (0.04%) | 2E-74 | 3-188 | 34-221 | 284 | 40 | 188 | ref|WP_003142477.1| | peptidyl-tRNA hydrolase [Aerococcus viridans] gb|EFG49684.1|... |
| 1182762 | Enterococcus sp. C1 | 1 (0.04%) | 3E-74 | 4-187 | 1-186 | 283 | 40 | 186 | ref|WP_008380153.1| | peptidyl-tRNA hydrolase [Enterococcus sp. C1] gb|EJF49250.1|... |
| 1259825 | Enterococcus casseliflavus 14-MB-W-14 | 1 (0.04%) | 3E-74 | 4-187 | 1-186 | 283 | 40 | 186 | ref|YP_007754142.1| | peptidyl-tRNA hydrolase [Enterococcus casseliflavus EC20] re... |
| 1260358 | Enterococcus faecalis 06-MB-DW-09 | 1 (0.04%) | 5E-74 | 3-187 | 6-192 | 282 | 40 | 187 | ref|WP_005233344.1| | peptidyl-tRNA hydrolase [Enterococcus] gb|EGC70522.1| aminoa... |
| 362948 | Lactobacillus salivarius UCC118 | 1 (0.04%) | 1E-72 | 4-187 | 1-185 | 278 | 40 | 186 | ref|YP_536249.1| | peptidyl-tRNA hydrolase [Lactobacillus salivarius UCC118] re... |
| 608538 | Hydrogenobacter thermophilus TK-6 | 1 (0.04%) | 5E-65 | 4-188 | 2-187 | 252 | 40 | 187 | ref|YP_003431784.1| | peptidyl-tRNA hydrolase [Hydrogenobacter thermophilus TK-6] ... |
| 562981 | Gemella haemolysans M341 | 1 (0.04%) | 2E-64 | 4-187 | 1-185 | 250 | 40 | 186 | ref|WP_003146417.1| | peptidyl-tRNA hydrolase [Gemella haemolysans] gb|EGF86564.1|... |
| 546270 | Gemella haemolysans ATCC 10379 | 1 (0.04%) | 6E-64 | 4-187 | 1-185 | 249 | 40 | 186 | ref|WP_003144984.1| | peptidyl-tRNA hydrolase [Gemella haemolysans] gb|EER67658.1|... |
| 655186 | uncultured SUP05 cluster bacterium | 1 (0.04%) | 2E-49 | 3-135 | 2-137 | 200 | 40 | 136 | gb|EEZ80198.1| | peptidyl-tRNA hydrolase [uncultured SUP05 cluster bacterium] |