old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 .
	MPTYKLIVGLGNLGKKYEKTRHNAGFMVLDRLASLFHLNFDKTNKLGDYLFIKEKAAILAKPATFMNNSGLFVKWLQDHFQIPLANIMIVHDEIAFDLGVIRLKMQGSANNHNGIKSVIRHLDTEQFNRLRFGIKSQNTSNILHEQVMSEFQNSELTKLEVAITKSVELLKRYIEGEELQRLMEYYHHG
tmhmm (0)	---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)	---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (5%)	X---------------------------------------------------------------------------------------------------------XXXXX---------------------------------------------------------------------------XXX
psipred	----EEEEE-----HHH--------HHHHHHHHHH------EE--EEEEEE---EEEEE----HHHH---HHHHHHHHHH-----EEEEEE--------EEEEE----------HHHHHHH-----EEEEEEE-------------------HHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHH---

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    25	    0.110
  max. Y    19	    0.126
  max. S    11	    0.187
  mean S     1-18   0.145
       D     1-18   0.134    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.134 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-189	alignment	3kjzA_201	1-191	0.9092	HYDROLASE

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
662947	Mycoplasma genitalium M2288	1 (0.04%)	3E-58	1-189	1-189	230	100	189	ref|NP_072745.1|	peptidyl-tRNA hydrolase [Mycoplasma genitalium G37] ref|YP_0...
1121865	Enterococcus columbae DSM 7374 = ATCC 51263	1 (0.04%)	1E-76	4-187	1-186	291	41	186	ref|WP_016183974.1|	peptidyl-tRNA hydrolase [Enterococcus columbae] gb|EOT39567....
712961	Lactobacillus salivarius CECT 5713	1 (0.04%)	7E-74	4-187	1-185	282	41	186	ref|YP_005864186.1|	Peptidyl-tRNA hydrolase (PTH) [Lactobacillus salivarius CECT...
748449	Halobacteroides halobius DSM 5150	1 (0.04%)	2E-73	4-187	1-185	280	41	186	ref|YP_007314214.1|	peptidyl-tRNA hydrolase [Halobacteroides halobius DSM 5150] ...
1108963	Lactobacillus salivarius SMXD51	1 (0.04%)	2E-73	4-187	1-185	280	41	186	ref|WP_003703198.1|	peptidyl-tRNA hydrolase [Lactobacillus salivarius] gb|EFK797...
1041521	Lactobacillus salivarius GJ-24	1 (0.04%)	4E-73	3-187	15-200	279	41	187	ref|WP_004564204.1|	peptidyl-tRNA hydrolase [Lactobacillus salivarius] gb|EGM521...
525364	Lactobacillus salivarius ATCC 11741	1 (0.04%)	4E-73	3-187	15-200	279	41	187	ref|WP_003701374.1|	peptidyl-tRNA hydrolase [Lactobacillus salivarius] gb|EEJ741...
46469	Orenia marismortui	1 (0.04%)	8E-73	4-187	1-184	278	41	186	ref|WP_018248276.1|	hypothetical protein [Orenia marismortui]
1273133	Lactobacillus salivarius cp400	1 (0.04%)	2E-72	4-187	1-185	277	41	186	emb|CDK34955.1|	Peptidyl-tRNA hydrolase (PTH) [Lactobacillus salivarius cp40...
526975	Bacillus cereus BDRD-ST26	1 (0.04%)	3E-62	2-139	20-159	243	41	140	ref|WP_002026814.1|	peptidyl-tRNA hydrolase [Bacillus cereus] gb|EEL02769.1| Pep...
1046596	Lactobacillus mali KCTC 3596 = DSM 20444	1 (0.04%)	8E-75	4-188	1-186	285	40	187	ref|WP_003687302.1|	peptidyl-tRNA hydrolase [Lactobacillus mali] gb|EJF01983.1| ...
655812	Aerococcus viridans ATCC 11563	1 (0.04%)	2E-74	3-188	34-221	284	40	188	ref|WP_003142477.1|	peptidyl-tRNA hydrolase [Aerococcus viridans] gb|EFG49684.1|...
1182762	Enterococcus sp. C1	1 (0.04%)	3E-74	4-187	1-186	283	40	186	ref|WP_008380153.1|	peptidyl-tRNA hydrolase [Enterococcus sp. C1] gb|EJF49250.1|...
1259825	Enterococcus casseliflavus 14-MB-W-14	1 (0.04%)	3E-74	4-187	1-186	283	40	186	ref|YP_007754142.1|	peptidyl-tRNA hydrolase [Enterococcus casseliflavus EC20] re...
1260358	Enterococcus faecalis 06-MB-DW-09	1 (0.04%)	5E-74	3-187	6-192	282	40	187	ref|WP_005233344.1|	peptidyl-tRNA hydrolase [Enterococcus] gb|EGC70522.1| aminoa...
362948	Lactobacillus salivarius UCC118	1 (0.04%)	1E-72	4-187	1-185	278	40	186	ref|YP_536249.1|	peptidyl-tRNA hydrolase [Lactobacillus salivarius UCC118] re...
608538	Hydrogenobacter thermophilus TK-6	1 (0.04%)	5E-65	4-188	2-187	252	40	187	ref|YP_003431784.1|	peptidyl-tRNA hydrolase [Hydrogenobacter thermophilus TK-6] ...
562981	Gemella haemolysans M341	1 (0.04%)	2E-64	4-187	1-185	250	40	186	ref|WP_003146417.1|	peptidyl-tRNA hydrolase [Gemella haemolysans] gb|EGF86564.1|...
546270	Gemella haemolysans ATCC 10379	1 (0.04%)	6E-64	4-187	1-185	249	40	186	ref|WP_003144984.1|	peptidyl-tRNA hydrolase [Gemella haemolysans] gb|EER67658.1|...
655186	uncultured SUP05 cluster bacterium	1 (0.04%)	2E-49	3-135	2-137	200	40	136	gb|EEZ80198.1|	peptidyl-tRNA hydrolase [uncultured SUP05 cluster bacterium]