old.robetta.org

A new Robetta server is available for structure prediction.

This service will be discontinued at the end of April 2026

     
Fragment Libraries    Alanine Scanning    DNA Interface Scan
[ Queue ] [ Submit ]    [ Queue ] [ Submit ]    [ Queue ] [ Submit ]
[ Register / Update ] [ Docs / FAQs ] [ Login ]


     
Job 81190 [SSGCID - MygeA.18964.a] [2018-02-01] [D-172-16-30-137.dhcp4.x.x] [Structure] [Complete] Uncharacterized protein MG371 - BATCH:81172

Full Structure Predictions  
Model 1

 chemical/x-pdb  MIME type  PDB file
Model 2

 chemical/x-pdb  MIME type  PDB file
Model 3

 chemical/x-pdb  MIME type  PDB file
Model 4

 chemical/x-pdb  MIME type  PDB file
Model 5

 chemical/x-pdb  MIME type  PDB file

Click the icons below each image to download the prediction in PDB format ( PDB file )

Images were produced using MolScript and Raster3D!




Plots powered by Plotly.js.

Features and Secondary Structure  
 
1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320 
 
MISIDPQFIKNFSKKVKQFDKFSLFVHVNPDFDAFGSAFAFKTFLNTFFSEKKAYVMGSYNINADGRELFPFEQTDINDDFVKESLAIIFDTSNQERVLTQKHKLAKETVRIDHHPRTEKFADMEWIDSSFSATAEMIGYLILQMGYKLNDEIASYLYAGIITDTQRFWGPTTTPQTFALTAKLMETGFNRNKVHDAVYLKPLLEHKYFSYVLSKAKITKNGLAYALIKKGAYKHFGVVSPLPMVHALNNIKGVKIWTTVYFNESIKKWIGSIRSRNIPINNFAQMFNGGGHKYAAAFVLDEKNQFMKLVQIMDDFLAKQNENS
tmhmm (0)
------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)
------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)
------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (2%)
XX------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXX
psipred
-----HHHHHHHHHHHH---EEEEEE-----HHHHHHHHHHHHHHHH----EEEEEE------HHHHHH--HHHHH---------EEEEEE---HHH--HHHHH---EEEEEE----------EEE-------HHHHHHHHHHHH-----HHHHHHHHHHHHHHHHH-------HHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHH--EEE---EEEEEE-HHH--------HHHH--HHH----HHHHHHHHH----EEEEEEE------HHHHHHH------HH--EEEE---HHHHHHHHHHHHHHHHH----

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    51	    0.118
  max. Y    19	    0.160
  max. S    11	    0.299
  mean S     1-18   0.219
       D     1-18   0.183    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.183 D-cutoff=0.450 Networks=SignalP-TM


Domain Repeats Prediction     Top
  Boundary     STD (+/-)     Consensus  
------


Ginzu Domain Prediction 1       Top
Domain Span Source Reference Parent   Parent Span     Confidence     Annotations  
  1-324     alignment     3w5wA_210     1-340   0.8117   --


PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA       Top
TaxID Species Alignments PSI-Blast Data (alignment with lowest E value)
E value Query Span Sbjct Span Bit Score Identity HSP Length Accession Description
662947Mycoplasma genitalium M22882 (0.06%)2E-941-3241-324352100324ref|NP_073043.1|DHH family protein [Mycoplasma genitalium G37] ref|YP_006599...
2097Mycoplasma genitalium4 (0.12%)5E-931-3241-32434799324ref|WP_009885936.1|hypothetical protein [Mycoplasma genitalium]
1238993Mycoplasma pneumoniae M129-B71 (0.03%)8E-811-3211-32130782321ref|NP_110238.1|phosphodiesterase [Mycoplasma pneumoniae M129] ref|YP_005175...
708616Mycoplasma gallisepticum str. F1 (0.03%)1E-7910-3189-31830359310ref|NP_853281.1|phosphodiesterase [Mycoplasma gallisepticum str. R(low)] ref...
1159204Mycoplasma gallisepticum NC08_2008.031-4-3P2 (0.06%)1E-7910-3189-31830359310ref|YP_006581382.1|phosphodiesterase [Mycoplasma gallisepticum VA94_7994-1-7P] ...
1006581Mycoplasma gallisepticum S62 (0.06%)2E-7910-3189-31830259310ref|YP_008894423.1|hypothetical protein GCW_02820 [Mycoplasma gallisepticum S6]...
272633Mycoplasma penetrans HF-21 (0.03%)2E-7321-31917-31728246302ref|NP_757971.1|phosphoesterase [Mycoplasma penetrans HF-2] ref|WP_011077407...
1048830Mycoplasma iowae 6951 (0.03%)1E-746-3212-31928644319ref|WP_004024659.1|phosphoesterase [Mycoplasma iowae] gb|EGZ31582.1| phosphoest...
399549Metallosphaera sedula DSM 53481 (0.03%)2E-4271-301250-280544231ref|YP_001191606.1|DHH superfamily phosphohydrolase [Metallosphaera sedula DSM ...
859194Mycoplasma haemofelis Ohio22 (0.06%)2E-624-3171-31924635319ref|YP_004192066.1|hypothetical protein HF1_02190 [Mycoplasma haemofelis str. L...
1116213Candidatus Mycoplasma haemominutum 'Birmingham 1'1 (0.03%)2E-6111-32019-33624235319ref|YP_007766306.1|DHH family phosphoesterase (MgpA-like protein) [Candidatus M...
768700Mycoplasma suis str. Illinois2 (0.06%)5E-616-32014-34424135332ref|YP_004250287.1|MgPa-like protein, DHH family phosphoesterase [Mycoplasma su...
708248Mycoplasma suis KI38062 (0.06%)2E-616-32414-34824234336ref|YP_004249365.1|tRNA-nucleotidyltransferase/poly(A) polymerase family protei...
1006007Bacillus megaterium WSH-0021 (0.03%)4E-9011-3034-29533833298ref|YP_005492661.1|phosphoesterase RecJ domain-containing protein [Bacillus meg...
592022Bacillus megaterium DSM 3192 (0.06%)1E-8911-3034-29533633298ref|YP_003599941.1|oligoribonuclease [Bacillus megaterium DSM 319] ref|WP_01308...
1404Bacillus megaterium1 (0.03%)2E-8911-3034-29533533298ref|WP_016765718.1|oligoribonuclease [Bacillus megaterium]
1033810Haloplasma contractile SSD-17B2 (0.06%)2E-8310-3223-31431533317ref|WP_008825757.1|hypothetical protein [Haloplasma contractile] gb|ERJ12830.1|...
545693Bacillus megaterium QM B15512 (0.06%)5E-9411-3204-31235032315ref|YP_003565218.1|oligoribonuclease [Bacillus megaterium QM B1551] ref|WP_0130...
1188240Mycoplasma yeatsii 139262 (0.06%)2E-814-3221-31930932323ref|WP_004427068.1|Phosphoesterase DHH family protein [Mycoplasma yeatsii] gb|E...
518637Eubacterium biforme DSM 39893 (0.09%)3E-6710-3133-30426132306ref|WP_003865895.1|hypothetical protein [[Eubacterium] biforme] gb|EEC89339.1| ...






Robetta is available for NON-COMMERCIAL USE ONLY at this time
[ Terms of Service ]
Copyright © 2004-2011 University of Washington