old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280 . 290 . 300 . 310 . 320 . 330 . 340 . 350 . 360 . 370 . 380 . 390 . 400 . 410 . 420 . 430 . 440
	MAKVYNQEVYVQFLKQHGFVFQSSEIYNGLNNSWDFGPLGAVLKQQIKQALYNFFIKNKADVLLVETPIILSELVWKASGHLANFVDTLVDCKSCKYRFRVDQINAEIKAKKDWNSFKVNCPNCHNQNWSEVRDFNLLFQTEIGVVNNDKRLVFLRPETAQGSFINFKNILQAKKRNLPFAIAQFGKSFRNEITPGNFLFRTREFEQFEIEWFCKPDDANSLFEKQLIMVEQFLQTVLKINPELLKKHEYDQSELAHYAKKTTDFLFNFPHGLKELWGLANRGDFDLKQHQEFSKKSMSFFDSELNQHFLPFIIEPAVGIERLFYALIVSSYRREIINEEEREVLSLPFDLCPEQIIVLPLVNKLKKEAFSVFETLAKTRWRVCFETTGSIGKRYRKADAIGIKYAVTFDFESLEDNAVTIRDRDTLVQQRIAIKELPQWFMKNGQ
tmhmm (0)	--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (2%)	--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXXXX-------------------------------------------------------------------------------------------------------
coiled-coils (0%)	--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (1%)	XXXX---X-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------X
psipred	----HHHHHHHHHHHH--------------EE-EEE---HHHHHHHHHHHHHHHHH-----EEEEE------HHH----------------------EEE-HHHHHHHHHHH---EEEE-----------------------------------------HHHHHHHHHHHHH------HHHHHHHHHH-------------EEEEE----EEE-HHHHHHHHHHHHHHHHHHHHHHH---HH---HHHHHHHHHHHHHHHHHHHHH-----EEE--------HHHHHHHH------HHHHHHH-------EEEEE----HHHHHHHHHHHHHHHH----EEE-----------EEEEE-----HHHHHHHHHHHHHH---EEEE-----HHHHHHHHHHH--EEEEEE----HH--EEEEEE-----EEEEEHHHHHHHHHHH--

# SignalP-4.0 gram- predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C     3	    0.104
  max. Y     3	    0.133
  max. S     2	    0.192
  mean S     1-2    0.181
       D     1-2    0.156    0.570  NO
Name=tmp_signalp_seq	SP='NO' D=0.156 D-cutoff=0.570 Networks=SignalP-noTM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-446	alignment	5e6mA_204	1-519	0.8591	--

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
662947	Mycoplasma genitalium M2288	1 (0.03%)	1E-147	1-446	1-446	527	100	446	ref|NP_072916.1|	glycyl-tRNA synthetase [Mycoplasma genitalium G37] ref|YP_00...
272633	Mycoplasma penetrans HF-2	1 (0.03%)	1E-147	1-446	1-459	529	50	460	ref|NP_757728.1|	glycyl-tRNA synthetase [Mycoplasma penetrans HF-2] ref|WP_01...
1159204	Mycoplasma gallisepticum NC08_2008.031-4-3P	1 (0.03%)	1E-140	4-445	2-461	504	50	460	ref|YP_006581272.1|	glycyl-tRNA synthetase [Mycoplasma gallisepticum VA94_7994-1...
1006581	Mycoplasma gallisepticum S6	1 (0.03%)	1E-139	4-445	2-461	503	50	460	ref|YP_005880714.1|	glycyl-tRNA synthetase [Mycoplasma gallisepticum str. F] ref...
710128	Mycoplasma gallisepticum str. R(high)	1 (0.03%)	1E-138	4-445	2-461	500	50	460	ref|NP_853173.2|	glycyl-tRNA synthetase [Mycoplasma gallisepticum str. R(low)...
1054943	Candidatus Arthromitus sp. SFB-2	1 (0.03%)	1E-112	121-446	2-326	413	48	327	ref|WP_007440647.1|	Putative tRNA synthetase class II, partial [Candidatus Arthr...
1048830	Mycoplasma iowae 695	1 (0.03%)	1E-79	1-252	1-263	304	48	264	ref|WP_004024997.1|	glycyl-tRNA synthetase [Mycoplasma iowae] gb|EGZ31294.1| gly...
1276227	Spiroplasma chrysopicola DF-1	1 (0.03%)	1E-153	4-446	2-455	549	46	456	ref|YP_008017676.1|	glycyl-tRNA synthetase [Spiroplasma chrysopicola DF-1] ref|W...
626096	Ureaplasma urealyticum serovar 2 str. ATCC 27814	2 (0.05%)	1E-146	3-444	4-462	526	46	459	ref|WP_004027418.1|	glycyl-tRNA synthetase [Ureaplasma urealyticum] gb|EEH02209....
626095	Ureaplasma urealyticum serovar 8 str. ATCC 27618	2 (0.05%)	1E-146	3-444	4-462	525	46	459	ref|YP_002284940.1|	glycyl-tRNA synthetase [Ureaplasma urealyticum serovar 10 st...
2130	Ureaplasma urealyticum	1 (0.03%)	1E-146	3-444	4-462	525	46	459	ref|WP_016829267.1|	glycyl-tRNA synthetase [Ureaplasma urealyticum]
519851	Ureaplasma parvum serovar 6 str. ATCC 27818	1 (0.03%)	1E-146	3-444	4-462	524	46	459	ref|WP_006688822.1|	glycyl-tRNA synthetase [Ureaplasma parvum] gb|EDU19490.1| gl...
515609	Ureaplasma parvum serovar 14 str. ATCC 33697	1 (0.03%)	1E-145	3-444	4-462	522	46	459	ref|WP_006689044.1|	glycyl-tRNA synthetase [Ureaplasma parvum] gb|EDT49174.1| gl...
505682	Ureaplasma parvum serovar 3 str. ATCC 27815	1 (0.03%)	1E-145	3-444	4-462	520	46	459	ref|NP_078330.1|	glycyl-tRNA synthetase [Ureaplasma parvum serovar 3 str. ATC...
77133	uncultured bacterium	41 (1.03%)	1E-158	1-441	1-450	566	45	453	gb|EKD47637.1|	hypothetical protein ACD_65C00350G0003 [uncultured bacterium...
1276229	Spiroplasma syrphidicola EA-1	1 (0.03%)	1E-155	4-446	2-455	553	45	456	ref|YP_008026452.1|	glycyl-tRNA synthetase [Spiroplasma syrphidicola EA-1] ref|W...
1179777	Mycoplasma sp. G5847	1 (0.03%)	1E-149	1-445	1-455	534	45	458	ref|WP_008363937.1|	glycine--tRNA ligase [Mycoplasma sp. G5847] gb|ELK19949.1| g...
340047	Mycoplasma capricolum subsp. capricolum ATCC 27343	1 (0.03%)	1E-149	1-445	1-455	534	45	458	ref|YP_424478.1|	glycyl-tRNA synthetase [Mycoplasma capricolum subsp. caprico...
866629	Mycoplasma leachii 99/014/6	1 (0.03%)	1E-149	1-445	1-455	534	45	458	ref|YP_004047263.1|	glycine--tRNA ligase [Mycoplasma leachii PG50] ref|YP_005907...
743965	Mycoplasma putrefaciens KS1	1 (0.03%)	1E-146	1-442	1-452	525	45	455	ref|YP_004790208.1|	glycyl-tRNA synthetase [Mycoplasma putrefaciens KS1] ref|WP_...