old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140
	MLILVNNPKAKYDYHLMESYCAGIVLKGSEVKALSLGQGSLKEAYVFVKNNELFLEQFTIPPYSFAGPLNHASDRIKKLLLNKHEIKQIINKKQQQSLSVIPSKVFFRNGKIKVEIWLAKPKKKFDKRETIKKKTIRRELEAEYR
tmhmm (0)	-------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (17%)	-------------------------------------------------------------------------------------XXXXXXXXXXX------------------------------XXXXXXXXXXXXX------
coiled-coils (14%)	---------------------------------------------------------------------------XXXXXXXXXXXXXXXXXXXXX-------------------------------------------------
disordered (8%)	------------------------------------------------------------------------------------------------------------------------------------XXXXX-XXXX-XX
psipred	---HHH-------EEEEEEEEEEEEE-HHHHHHHH---EEEE--EEEEE---EEEEE----HHHH----------HHHHHHHHHHHHHHHHHHH----EEEEEEEEEE--EEEEEEEEEE---HHHHHHHHHHHHHHHHHHHHH-

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    34	    0.149
  max. Y    34	    0.160
  max. S    11	    0.270
  mean S     1-33   0.163
       D     1-33   0.161    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.161 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-145	alignment	1k8hA_201	1-133	0.7517	RNA BINDING PROTEIN

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
201089	uncultured Desulfobacterium sp.	1 (0.04%)	2E-54	2-142	7-147	217	48	141	emb|CBX30012.1|	SsrA-binding protein [uncultured Desulfobacterium sp.]
88274	delta proteobacterium NaphS2	1 (0.04%)	4E-54	1-145	3-147	216	48	145	ref|WP_006424604.1|	single-stranded DNA-binding protein [delta proteobacterium N...
760142	Hippea maritima DSM 10411	1 (0.04%)	3E-52	7-144	6-144	210	48	139	ref|YP_004340205.1|	SsrA-binding protein [Hippea maritima DSM 10411] ref|WP_0136...
177437	Desulfobacterium autotrophicum HRM2	1 (0.04%)	4E-55	1-145	6-150	219	47	145	ref|YP_002603169.1|	protein SmpB [Desulfobacterium autotrophicum HRM2] ref|WP_01...
96561	Desulfococcus oleovorans Hxd3	1 (0.04%)	7E-54	1-145	15-159	215	47	145	ref|YP_001530577.1|	SsrA-binding protein [Desulfococcus oleovorans Hxd3] ref|WP_...
1006581	Mycoplasma gallisepticum S6	1 (0.04%)	7E-36	1-142	1-142	155	47	142	ref|YP_005880666.1|	SsrA-binding protein [Mycoplasma gallisepticum str. F] ref|Y...
1159204	Mycoplasma gallisepticum NC08_2008.031-4-3P	1 (0.04%)	1E-35	1-142	1-142	154	47	142	ref|NP_853225.2|	SsrA-binding protein [Mycoplasma gallisepticum str. R(low)] ...
209882	Fusobacterium nucleatum subsp. vincentii ATCC 49256	1 (0.04%)	4E-17	3-60	2-59	93	47	58	ref|WP_005892549.1|	Small protein B [Fusobacterium nucleatum] gb|EAA23424.1| Sma...
644282	Desulfarculus baarsii DSM 2075	1 (0.04%)	8E-59	2-145	7-150	232	46	144	ref|YP_003809106.1|	SsrA-binding protein [Desulfarculus baarsii DSM 2075] ref|WP...
1158318	Desulfurobacterium sp. TC5-1	1 (0.04%)	6E-55	5-145	9-150	218	46	142	ref|WP_022847384.1|	single-stranded DNA-binding protein [Desulfurobacterium sp. ...
655811	Anaerococcus vaginalis ATCC 51170	1 (0.04%)	3E-49	1-145	1-145	200	46	145	ref|WP_004838881.1|	single-stranded DNA-binding protein [Anaerococcus vaginalis]...
37692	Candidatus Phytoplasma mali	1 (0.04%)	2E-33	2-142	6-146	147	46	141	ref|YP_002004361.1|	SsrA-binding protein [Candidatus Phytoplasma mali] ref|WP_01...
101571	Burkholderia ubonensis	2 (0.07%)	2E-22	4-76	3-76	110	46	74	ref|WP_010092082.1|	SsrA-binding protein, partial [Burkholderia ubonensis]
289376	Thermodesulfovibrio yellowstonii DSM 11347	1 (0.04%)	1E-59	1-145	3-147	234	45	145	ref|YP_002249012.1|	SsrA-binding protein [Thermodesulfovibrio yellowstonii DSM 1...
428126	Clostridium spiroforme DSM 1552	1 (0.04%)	4E-59	1-145	3-148	232	45	146	ref|WP_004609491.1|	single-stranded DNA-binding protein [[Clostridium] spiroform...
1120938	Actinomadura flavalba	1 (0.04%)	4E-56	2-140	8-146	222	45	139	ref|WP_018653397.1|	single-stranded DNA-binding protein [Actinomadura flavalba]
204536	Sulfurihydrogenibium azorense Az-Fu1	1 (0.04%)	1E-55	2-145	4-147	221	45	144	ref|YP_002729499.1|	SsrA-binding protein [Sulfurihydrogenibium azorense Az-Fu1] ...
396598	Burkholderia graminis C4D1M	1 (0.04%)	2E-55	4-145	3-145	220	45	143	ref|WP_006048693.1|	single-stranded DNA-binding protein [Burkholderia graminis] ...
640511	Burkholderia sp. CCGE1002	1 (0.04%)	3E-55	4-145	3-145	219	45	143	ref|YP_003605329.1|	SsrA-binding protein [Burkholderia sp. CCGE1002] ref|WP_0130...
243261	Burkholderia sp. Ch1-1	1 (0.04%)	4E-55	4-145	3-145	219	45	143	ref|WP_007181451.1|	single-stranded DNA-binding protein [Burkholderia sp. Ch1-1]...