old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280 . 290 . 300 .
	MKQCFVVTTTKRLDSLLASLLNLSRVKVVKLIMNGQIKVNEKLTFKNSLIVAKDDVIKVEIHDETTSDFITSVEPYNLKLEVLFEDKDLMVINKPSGLLTHPTTFNEKASLLAACIFHNNKNPVYLVHRLDRDTSGAIVVCKNQASLLNLQNQLQNRTLKRYYVALVHFPFNALTGSINAPLARVNNNKVMFKIAQTAKAKQAITKFKVINQNEKAALISLELLTGRTHQIRVHLKFIQHPVYNDPLYGIKSEKKDSYGQFLHANRICFIHPTLNKPMDFHAPLEPKFSTKLKSLNLSLTDPLHVLFK
tmhmm (0)	--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (18%)	------------XXXXXXXXXXXX----------------------------------------------------------------------------------------------------------------------XXXXXXXXXXXXXX-----------------------------------XXXXXXXXXXXXXXXXX--------------------------------------------------------------------------------XXXXXXXXXXXX--------
coiled-coils (0%)	--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (1%)	X------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXX----
psipred	-EEEEE-----HHHHHHHH-----HHHHHHHHH---EEE--EE------------EEEEE---------------------EEEE---EEEEE-----EEE--------HHHHHHHHH------EEE--------EEEEEE--HHHHHHHHHHHHH----EEEEEEEE-------EEEEEEEEE------EEEEE------EEEEEEEEEEEE--EEEEEEEE----HHHHHHHHHH----EE-------------------EEEEEEEE------EEEEEE--HHHHHHHHHHH-------HHHH--

# SignalP-4.0 gram- predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    31	    0.107
  max. Y    11	    0.241
  max. S     6	    0.730
  mean S     1-10   0.612
       D     1-10   0.416    0.570  NO
Name=tmp_signalp_seq	SP='NO' D=0.416 D-cutoff=0.570 Networks=SignalP-noTM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-308	alignment	3dh3A_110	1-240	0.6810	ISOMERASE/RNA

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
662947	Mycoplasma genitalium M2288	1 (0.03%)	4E-86	1-308	1-308	324	100	308	ref|NP_072871.1|	RluA family pseudouridine synthase [Mycoplasma genitalium G3...
1112856	Mycoplasma pneumoniae 309	1 (0.03%)	7E-82	1-308	1-309	310	59	309	ref|YP_005175531.1|	putative RluA family pseudouridine synthase [Mycoplasma pneu...
337330	Lactobacillus plantarum subsp. plantarum	1 (0.03%)	7E-35	179-297	2-117	154	46	119	emb|CAJ75876.1|	hypothetical protein [Lactobacillus plantarum subsp. plantar...
710128	Mycoplasma gallisepticum str. R(high)	1 (0.03%)	8E-72	2-308	3-311	277	45	309	ref|NP_852991.2|	pseudouridine synthase [Mycoplasma gallisepticum str. R(low)...
1006581	Mycoplasma gallisepticum S6	1 (0.03%)	8E-72	2-308	3-311	277	45	309	ref|YP_005880899.1|	Pseudouridine synthase [Mycoplasma gallisepticum str. F] ref...
1284223	Lactobacillus plantarum UCMA 3037	1 (0.03%)	1E-90	2-297	18-312	339	40	303	ref|WP_003645062.1|	Pseudouridine synthase [Lactobacillus plantarum] gb|EMP45198...
767468	Lactobacillus plantarum subsp. plantarum P-8	1 (0.03%)	1E-90	2-297	21-315	339	40	303	ref|YP_007987026.1|	Pseudouridine synthase [Lactobacillus plantarum subsp. plant...
644042	Lactobacillus plantarum JDM1	1 (0.03%)	3E-90	2-297	8-302	338	40	303	ref|YP_003063081.1|	pseudouridylate synthase [Lactobacillus plantarum JDM1] ref|...
1036177	Lactobacillus plantarum subsp. plantarum NC8	1 (0.03%)	2E-90	2-297	8-302	338	40	303	ref|WP_003644387.1|	RNA pseudouridine synthase [Lactobacillus plantarum] gb|EHS8...
1327988	Lactobacillus plantarum 16	1 (0.03%)	2E-90	2-297	8-302	338	40	303	ref|YP_003924734.1|	pseudouridylate synthase [Lactobacillus plantarum subsp. pla...
525338	Lactobacillus plantarum subsp. plantarum ATCC 14917	1 (0.03%)	6E-90	2-297	21-315	337	40	303	ref|WP_003640509.1|	RNA pseudouridine synthase [Lactobacillus plantarum] gb|EFK3...
1136177	Lactobacillus pentosus KCA1	1 (0.03%)	3E-92	2-297	8-302	344	39	303	ref|WP_003638764.1|	RNA pseudouridine synthase [Lactobacillus pentosus] gb|EIW13...
1590	Lactobacillus plantarum	3 (0.08%)	7E-92	2-297	8-302	343	39	303	ref|WP_021336558.1|	RNA pseudouridine synthase [Lactobacillus plantarum] gb|EQM5...
518637	Eubacterium biforme DSM 3989	1 (0.03%)	2E-85	12-296	16-300	322	39	292	ref|WP_003864043.1|	RNA pseudouridine synthase [[Eubacterium] biforme] gb|EEC911...
797516	Lactobacillus kisonensis F0435	1 (0.03%)	1E-92	1-304	1-301	346	38	311	ref|WP_008856789.1|	RNA pseudouridine synthase [Lactobacillus kisonensis] gb|EHO...
1185325	Lactobacillus coryniformis subsp. coryniformis CECT 5711	1 (0.03%)	1E-91	1-300	1-303	342	38	311	ref|WP_003679112.1|	RNA pseudouridine synthase [Lactobacillus coryniformis] gb|E...
1610	Lactobacillus coryniformis	1 (0.03%)	1E-91	1-300	1-303	342	38	311	ref|WP_010009926.1|	RNA pseudouridine synthase [Lactobacillus coryniformis]
702455	Listeria innocua FSL J1-023	1 (0.03%)	8E-89	9-296	8-294	333	38	295	ref|WP_003767467.1|	RNA pseudouridine synthase [Listeria innocua] gb|EFR93499.1|...
585524	Lactobacillus amylolyticus DSM 11664	1 (0.03%)	7E-89	3-298	6-301	333	38	304	ref|WP_006351798.1|	RNA pseudouridine synthase [Lactobacillus amylolyticus] gb|E...
1133596	Pediococcus pentosaceus IE-3	2 (0.05%)	9E-86	8-296	5-292	323	38	296	ref|WP_002833057.1|	pseudouridine synthase, RluA family protein [Pediococcus pen...