| Features and Secondary Structure |
| | 1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280 . 290 . 300 . |
| | MKQCFVVTTTKRLDSLLASLLNLSRVKVVKLIMNGQIKVNEKLTFKNSLIVAKDDVIKVEIHDETTSDFITSVEPYNLKLEVLFEDKDLMVINKPSGLLTHPTTFNEKASLLAACIFHNNKNPVYLVHRLDRDTSGAIVVCKNQASLLNLQNQLQNRTLKRYYVALVHFPFNALTGSINAPLARVNNNKVMFKIAQTAKAKQAITKFKVINQNEKAALISLELLTGRTHQIRVHLKFIQHPVYNDPLYGIKSEKKDSYGQFLHANRICFIHPTLNKPMDFHAPLEPKFSTKLKSLNLSLTDPLHVLFK |
| tmhmm (0) | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| low complexity (18%) | ------------XXXXXXXXXXXX----------------------------------------------------------------------------------------------------------------------XXXXXXXXXXXXXX-----------------------------------XXXXXXXXXXXXXXXXX--------------------------------------------------------------------------------XXXXXXXXXXXX-------- |
| coiled-coils (0%) | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| disordered (1%) | X------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXX---- |
| psipred | -EEEEE-----HHHHHHHH-----HHHHHHHHH---EEE--EE------------EEEEE---------------------EEEE---EEEEE-----EEE--------HHHHHHHHH------EEE--------EEEEEE--HHHHHHHHHHHHH----EEEEEEEE-------EEEEEEEEE------EEEEE------EEEEEEEEEEEE--EEEEEEEE----HHHHHHHHHH----EE-------------------EEEEEEEE------EEEEEE--HHHHHHHHHHH-------HHHH-- |
PSI-BLAST Sequence Hits (Top 20 by Identity) ALL DATA
|
| TaxID |
Species |
Alignments |
PSI-Blast Data (alignment with lowest E value) |
| E value |
Query Span |
Sbjct Span |
Bit Score |
Identity |
HSP Length |
Accession |
Description |
| 662947 | Mycoplasma genitalium M2288 | 1 (0.03%) | 4E-86 | 1-308 | 1-308 | 324 | 100 | 308 | ref|NP_072871.1| | RluA family pseudouridine synthase [Mycoplasma genitalium G3... |
| 1112856 | Mycoplasma pneumoniae 309 | 1 (0.03%) | 7E-82 | 1-308 | 1-309 | 310 | 59 | 309 | ref|YP_005175531.1| | putative RluA family pseudouridine synthase [Mycoplasma pneu... |
| 337330 | Lactobacillus plantarum subsp. plantarum | 1 (0.03%) | 7E-35 | 179-297 | 2-117 | 154 | 46 | 119 | emb|CAJ75876.1| | hypothetical protein [Lactobacillus plantarum subsp. plantar... |
| 710128 | Mycoplasma gallisepticum str. R(high) | 1 (0.03%) | 8E-72 | 2-308 | 3-311 | 277 | 45 | 309 | ref|NP_852991.2| | pseudouridine synthase [Mycoplasma gallisepticum str. R(low)... |
| 1006581 | Mycoplasma gallisepticum S6 | 1 (0.03%) | 8E-72 | 2-308 | 3-311 | 277 | 45 | 309 | ref|YP_005880899.1| | Pseudouridine synthase [Mycoplasma gallisepticum str. F] ref... |
| 1284223 | Lactobacillus plantarum UCMA 3037 | 1 (0.03%) | 1E-90 | 2-297 | 18-312 | 339 | 40 | 303 | ref|WP_003645062.1| | Pseudouridine synthase [Lactobacillus plantarum] gb|EMP45198... |
| 767468 | Lactobacillus plantarum subsp. plantarum P-8 | 1 (0.03%) | 1E-90 | 2-297 | 21-315 | 339 | 40 | 303 | ref|YP_007987026.1| | Pseudouridine synthase [Lactobacillus plantarum subsp. plant... |
| 644042 | Lactobacillus plantarum JDM1 | 1 (0.03%) | 3E-90 | 2-297 | 8-302 | 338 | 40 | 303 | ref|YP_003063081.1| | pseudouridylate synthase [Lactobacillus plantarum JDM1] ref|... |
| 1036177 | Lactobacillus plantarum subsp. plantarum NC8 | 1 (0.03%) | 2E-90 | 2-297 | 8-302 | 338 | 40 | 303 | ref|WP_003644387.1| | RNA pseudouridine synthase [Lactobacillus plantarum] gb|EHS8... |
| 1327988 | Lactobacillus plantarum 16 | 1 (0.03%) | 2E-90 | 2-297 | 8-302 | 338 | 40 | 303 | ref|YP_003924734.1| | pseudouridylate synthase [Lactobacillus plantarum subsp. pla... |
| 525338 | Lactobacillus plantarum subsp. plantarum ATCC 14917 | 1 (0.03%) | 6E-90 | 2-297 | 21-315 | 337 | 40 | 303 | ref|WP_003640509.1| | RNA pseudouridine synthase [Lactobacillus plantarum] gb|EFK3... |
| 1136177 | Lactobacillus pentosus KCA1 | 1 (0.03%) | 3E-92 | 2-297 | 8-302 | 344 | 39 | 303 | ref|WP_003638764.1| | RNA pseudouridine synthase [Lactobacillus pentosus] gb|EIW13... |
| 1590 | Lactobacillus plantarum | 3 (0.08%) | 7E-92 | 2-297 | 8-302 | 343 | 39 | 303 | ref|WP_021336558.1| | RNA pseudouridine synthase [Lactobacillus plantarum] gb|EQM5... |
| 518637 | Eubacterium biforme DSM 3989 | 1 (0.03%) | 2E-85 | 12-296 | 16-300 | 322 | 39 | 292 | ref|WP_003864043.1| | RNA pseudouridine synthase [[Eubacterium] biforme] gb|EEC911... |
| 797516 | Lactobacillus kisonensis F0435 | 1 (0.03%) | 1E-92 | 1-304 | 1-301 | 346 | 38 | 311 | ref|WP_008856789.1| | RNA pseudouridine synthase [Lactobacillus kisonensis] gb|EHO... |
| 1185325 | Lactobacillus coryniformis subsp. coryniformis CECT 5711 | 1 (0.03%) | 1E-91 | 1-300 | 1-303 | 342 | 38 | 311 | ref|WP_003679112.1| | RNA pseudouridine synthase [Lactobacillus coryniformis] gb|E... |
| 1610 | Lactobacillus coryniformis | 1 (0.03%) | 1E-91 | 1-300 | 1-303 | 342 | 38 | 311 | ref|WP_010009926.1| | RNA pseudouridine synthase [Lactobacillus coryniformis] |
| 702455 | Listeria innocua FSL J1-023 | 1 (0.03%) | 8E-89 | 9-296 | 8-294 | 333 | 38 | 295 | ref|WP_003767467.1| | RNA pseudouridine synthase [Listeria innocua] gb|EFR93499.1|... |
| 585524 | Lactobacillus amylolyticus DSM 11664 | 1 (0.03%) | 7E-89 | 3-298 | 6-301 | 333 | 38 | 304 | ref|WP_006351798.1| | RNA pseudouridine synthase [Lactobacillus amylolyticus] gb|E... |
| 1133596 | Pediococcus pentosaceus IE-3 | 2 (0.05%) | 9E-86 | 8-296 | 5-292 | 323 | 38 | 296 | ref|WP_002833057.1| | pseudouridine synthase, RluA family protein [Pediococcus pen... |