old.robetta.org

A new Robetta server is available for structure prediction.

This service will be discontinued at the end of April 2026

     
Fragment Libraries    Alanine Scanning    DNA Interface Scan
[ Queue ] [ Submit ]    [ Queue ] [ Submit ]    [ Queue ] [ Submit ]
[ Register / Update ] [ Docs / FAQs ] [ Login ]


     
Job 81202 [SSGCID - MygeA.19975.a] [2018-02-01] [D-172-16-30-137.dhcp4.x.x] [Structure] [Complete] MgpA Bifunctional oligoribonuclease and PAP phosphatase NrnA (MG190) - BATCH:81172

Full Structure Predictions  
Model 1

 chemical/x-pdb  MIME type  PDB file
Model 2

 chemical/x-pdb  MIME type  PDB file
Model 3

 chemical/x-pdb  MIME type  PDB file
Model 4

 chemical/x-pdb  MIME type  PDB file
Model 5

 chemical/x-pdb  MIME type  PDB file

Click the icons below each image to download the prediction in PDB format ( PDB file )

Images were produced using MolScript and Raster3D!




Plots powered by Plotly.js.

Features and Secondary Structure  
 
1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .
 
MKKGSITEAINAIKQFDKIVIFHHVRPDGDCLGAQQGLFHLIKANFKNKEVKCVGNNNNLFSFINMTFTNQIDESFLKEALAIVVDANYKNRIELRELLDKNLFKAVLRIDHHPNEDDLNTSFNFVEESYVACCEQIVEMATVAKWTIPPVAATLLYIGIYTDSNRFLYSNTSYRTLYLAAILYKAKADIRIVHDHLNHTSLADLKFKKYVYNHFKTQGQVIYFICTKKIQKRLRMTADQCARVNLLSNIADYKIWLFFIEQANNEIRIDLRSNGINVRDIAIKYGGGGHNNASGAIITNKKQISDVVSDCVKKIVYN
tmhmm (0)
------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (4%)
--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXXXXX----------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)
------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (1%)
XXXX--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
psipred
--HHHHHHHHHHHH---EEEEEE-----HHHHHHHHHHHHHHHH----EEEEE-----HHHHHHHHHHHHHHHH------EEEEEE---HHH---HHHHHHH---EEEEEE-----------EEEEE----HHHHHHHHHHHH------HHHHHHHHHHHHHHH---------HHHHHHHHHHHH----HHHHHHHHH---HHHHHHHHHHHHHHHHH----EEEEEHHHHH-----HHHHHHHHHHHEEEE-HHHHEEEE----EEEEEE------HHHHHHH------HH--EEEE--HHHHHHHHHHHHHHHH--

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    34	    0.111
  max. Y    50	    0.128
  max. S    46	    0.236
  mean S     1-49   0.120
       D     1-49   0.125    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.125 D-cutoff=0.450 Networks=SignalP-TM


Domain Repeats Prediction     Top
  Boundary     STD (+/-)     Consensus  
------


Ginzu Domain Prediction 1       Top
Domain Span Source Reference Parent   Parent Span     Confidence     Annotations  
  1-318     alignment     5ippB_304     1-316   0.8981   --


PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA       Top
TaxID Species Alignments PSI-Blast Data (alignment with lowest E value)
E value Query Span Sbjct Span Bit Score Identity HSP Length Accession Description
2097Mycoplasma genitalium5 (0.15%)9E-911-3181-318340100318ref|NP_072853.2|DHH family phosphoesterase [Mycoplasma genitalium G37] ref|W...
662947Mycoplasma genitalium M22881 (0.03%)9E-911-3181-31834099318ref|YP_006600214.1|DHH family phosphoesterase [Mycoplasma genitalium M6282] ref...
663918Mycoplasma genitalium M23211 (0.03%)7E-901-3181-31833798318ref|YP_006599726.1|DHH family phosphoesterase [Mycoplasma genitalium M2321] ref...
1238993Mycoplasma pneumoniae M129-B71 (0.03%)9E-823-3158-32231061315ref|NP_109828.1|DHH family phosphoesterase [Mycoplasma pneumoniae M129] ref|...
1006581Mycoplasma gallisepticum S61 (0.03%)5E-781-3151-31629754317ref|YP_005880328.1|exopolyphosphatase-like protein [Mycoplasma gallisepticum st...
1159204Mycoplasma gallisepticum NC08_2008.031-4-3P1 (0.03%)6E-781-3151-31629754317ref|YP_006580899.1|exopolyphosphatase-like protein [Mycoplasma gallisepticum VA...
1159202Mycoplasma gallisepticum NC06_2006.080-5-2P1 (0.03%)6E-781-3151-31629754317ref|YP_006584697.1|exopolyphosphatase-like protein [Mycoplasma gallisepticum NC...
710128Mycoplasma gallisepticum str. R(high)1 (0.03%)2E-771-3151-31629554317ref|NP_852819.2|exopolyphosphatase-related protein [Mycoplasma gallisepticum...
1118964Mycoplasma hyorhinis SK762 (0.06%)3E-781-3151-31529849315ref|YP_007012587.1|MgpA-like DHH family phosphoesterase [Mycoplasma hyorhinis S...
634997Mycoplasma hyorhinis DBS 10502 (0.06%)2E-771-3151-31529649315ref|YP_005204789.1|DHH family protein [Mycoplasma hyorhinis GDL-1] ref|YP_00590...
2099Mycoplasma hyopneumoniae2 (0.06%)2E-791-3151-31230247315ref|YP_278811.1|DHH family phosphoesterase [Mycoplasma hyopneumoniae J] ref|...
2110Mycoplasma agalactiae3 (0.09%)7E-861-3151-31532346315ref|YP_003515634.1|hypothetical protein MAGa4670 [Mycoplasma agalactiae] ref|WP...
347257Mycoplasma agalactiae PG23 (0.09%)2E-851-3151-31532246315ref|YP_001256584.1|hypothetical protein MAG_4450 [Mycoplasma agalactiae PG2] re...
1188239Mycoplasma ovipneumoniae 148112 (0.06%)3E-801-3151-31530546315gb|EXU61042.1|Hypothetical protein, putative DHH phosphoesterase [Mycoplas...
1131454Mycoplasma canis UFG12 (0.06%)3E-801-3171-31830546318ref|WP_004796698.1|nrnA-like DHH family phosphoesterase [Mycoplasma canis] gb|E...
1117644Mycoplasma canis PG 142 (0.06%)1E-791-3171-31830346318ref|WP_004794660.1|nrnA-like DHH family phosphoesterase [Mycoplasma canis] gb|E...
295358Mycoplasma hyopneumoniae 2321 (0.03%)3E-761-3154-31829146315ref|YP_115521.1|hypothetical protein mhp006 [Mycoplasma hyopneumoniae 232] r...
1110504Mycoplasma agalactiae 146282 (0.06%)3E-861-3151-31532445315ref|WP_004023855.1|Hypothetical protein [Mycoplasma agalactiae] gb|EIN15390.1| ...
1004152Mycoplasma flocculare ATCC 277161 (0.03%)5E-811-3151-31530745315ref|WP_002557473.1|DHH family phosphoesterase [Mycoplasma flocculare] gb|ENX512...
29562Mycoplasma ovipneumoniae2 (0.06%)3E-781-3151-31529845315ref|WP_010321008.1|DHH family phosphoesterase [Mycoplasma ovipneumoniae]






Robetta is available for NON-COMMERCIAL USE ONLY at this time
[ Terms of Service ]
Copyright © 2004-2011 University of Washington