| Features and Secondary Structure |
| | 1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280 . 290 . 300 . 310 . |
| | MKKGSITEAINAIKQFDKIVIFHHVRPDGDCLGAQQGLFHLIKANFKNKEVKCVGNNNNLFSFINMTFTNQIDESFLKEALAIVVDANYKNRIELRELLDKNLFKAVLRIDHHPNEDDLNTSFNFVEESYVACCEQIVEMATVAKWTIPPVAATLLYIGIYTDSNRFLYSNTSYRTLYLAAILYKAKADIRIVHDHLNHTSLADLKFKKYVYNHFKTQGQVIYFICTKKIQKRLRMTADQCARVNLLSNIADYKIWLFFIEQANNEIRIDLRSNGINVRDIAIKYGGGGHNNASGAIITNKKQISDVVSDCVKKIVYN |
| tmhmm (0) | ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ |
| low complexity (4%) | --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXXXXX---------------------------------------------------------------------------------------------------------------------------------- |
| coiled-coils (0%) | ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ |
| disordered (1%) | XXXX-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| psipred | --HHHHHHHHHHHH---EEEEEE-----HHHHHHHHHHHHHHHH----EEEEE-----HHHHHHHHHHHHHHHH------EEEEEE---HHH---HHHHHHH---EEEEEE-----------EEEEE----HHHHHHHHHHHH------HHHHHHHHHHHHHHH---------HHHHHHHHHHHH----HHHHHHHHH---HHHHHHHHHHHHHHHHH----EEEEEHHHHH-----HHHHHHHHHHHEEEE-HHHHEEEE----EEEEEE------HHHHHHH------HH--EEEE--HHHHHHHHHHHHHHHH-- |
PSI-BLAST Sequence Hits (Top 20 by Identity) ALL DATA
 |
| TaxID |
Species |
Alignments |
PSI-Blast Data (alignment with lowest E value) |
| E value |
Query Span |
Sbjct Span |
Bit Score |
Identity |
HSP Length |
Accession |
Description |
| 2097 | Mycoplasma genitalium | 5 (0.15%) | 9E-91 | 1-318 | 1-318 | 340 | 100 | 318 | ref|NP_072853.2| | DHH family phosphoesterase [Mycoplasma genitalium G37] ref|W... |
| 662947 | Mycoplasma genitalium M2288 | 1 (0.03%) | 9E-91 | 1-318 | 1-318 | 340 | 99 | 318 | ref|YP_006600214.1| | DHH family phosphoesterase [Mycoplasma genitalium M6282] ref... |
| 663918 | Mycoplasma genitalium M2321 | 1 (0.03%) | 7E-90 | 1-318 | 1-318 | 337 | 98 | 318 | ref|YP_006599726.1| | DHH family phosphoesterase [Mycoplasma genitalium M2321] ref... |
| 1238993 | Mycoplasma pneumoniae M129-B7 | 1 (0.03%) | 9E-82 | 3-315 | 8-322 | 310 | 61 | 315 | ref|NP_109828.1| | DHH family phosphoesterase [Mycoplasma pneumoniae M129] ref|... |
| 1006581 | Mycoplasma gallisepticum S6 | 1 (0.03%) | 5E-78 | 1-315 | 1-316 | 297 | 54 | 317 | ref|YP_005880328.1| | exopolyphosphatase-like protein [Mycoplasma gallisepticum st... |
| 1159204 | Mycoplasma gallisepticum NC08_2008.031-4-3P | 1 (0.03%) | 6E-78 | 1-315 | 1-316 | 297 | 54 | 317 | ref|YP_006580899.1| | exopolyphosphatase-like protein [Mycoplasma gallisepticum VA... |
| 1159202 | Mycoplasma gallisepticum NC06_2006.080-5-2P | 1 (0.03%) | 6E-78 | 1-315 | 1-316 | 297 | 54 | 317 | ref|YP_006584697.1| | exopolyphosphatase-like protein [Mycoplasma gallisepticum NC... |
| 710128 | Mycoplasma gallisepticum str. R(high) | 1 (0.03%) | 2E-77 | 1-315 | 1-316 | 295 | 54 | 317 | ref|NP_852819.2| | exopolyphosphatase-related protein [Mycoplasma gallisepticum... |
| 1118964 | Mycoplasma hyorhinis SK76 | 2 (0.06%) | 3E-78 | 1-315 | 1-315 | 298 | 49 | 315 | ref|YP_007012587.1| | MgpA-like DHH family phosphoesterase [Mycoplasma hyorhinis S... |
| 634997 | Mycoplasma hyorhinis DBS 1050 | 2 (0.06%) | 2E-77 | 1-315 | 1-315 | 296 | 49 | 315 | ref|YP_005204789.1| | DHH family protein [Mycoplasma hyorhinis GDL-1] ref|YP_00590... |
| 2099 | Mycoplasma hyopneumoniae | 2 (0.06%) | 2E-79 | 1-315 | 1-312 | 302 | 47 | 315 | ref|YP_278811.1| | DHH family phosphoesterase [Mycoplasma hyopneumoniae J] ref|... |
| 2110 | Mycoplasma agalactiae | 3 (0.09%) | 7E-86 | 1-315 | 1-315 | 323 | 46 | 315 | ref|YP_003515634.1| | hypothetical protein MAGa4670 [Mycoplasma agalactiae] ref|WP... |
| 347257 | Mycoplasma agalactiae PG2 | 3 (0.09%) | 2E-85 | 1-315 | 1-315 | 322 | 46 | 315 | ref|YP_001256584.1| | hypothetical protein MAG_4450 [Mycoplasma agalactiae PG2] re... |
| 1188239 | Mycoplasma ovipneumoniae 14811 | 2 (0.06%) | 3E-80 | 1-315 | 1-315 | 305 | 46 | 315 | gb|EXU61042.1| | Hypothetical protein, putative DHH phosphoesterase [Mycoplas... |
| 1131454 | Mycoplasma canis UFG1 | 2 (0.06%) | 3E-80 | 1-317 | 1-318 | 305 | 46 | 318 | ref|WP_004796698.1| | nrnA-like DHH family phosphoesterase [Mycoplasma canis] gb|E... |
| 1117644 | Mycoplasma canis PG 14 | 2 (0.06%) | 1E-79 | 1-317 | 1-318 | 303 | 46 | 318 | ref|WP_004794660.1| | nrnA-like DHH family phosphoesterase [Mycoplasma canis] gb|E... |
| 295358 | Mycoplasma hyopneumoniae 232 | 1 (0.03%) | 3E-76 | 1-315 | 4-318 | 291 | 46 | 315 | ref|YP_115521.1| | hypothetical protein mhp006 [Mycoplasma hyopneumoniae 232] r... |
| 1110504 | Mycoplasma agalactiae 14628 | 2 (0.06%) | 3E-86 | 1-315 | 1-315 | 324 | 45 | 315 | ref|WP_004023855.1| | Hypothetical protein [Mycoplasma agalactiae] gb|EIN15390.1| ... |
| 1004152 | Mycoplasma flocculare ATCC 27716 | 1 (0.03%) | 5E-81 | 1-315 | 1-315 | 307 | 45 | 315 | ref|WP_002557473.1| | DHH family phosphoesterase [Mycoplasma flocculare] gb|ENX512... |
| 29562 | Mycoplasma ovipneumoniae | 2 (0.06%) | 3E-78 | 1-315 | 1-315 | 298 | 45 | 315 | ref|WP_010321008.1| | DHH family phosphoesterase [Mycoplasma ovipneumoniae] |
