old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150
	MFANLIAEKLQKLQLSVATAESVTGGLLAHCLTSIDGASNYFNGGVIAYNNQVKINLLNVQSSTIANHGAVSSFCAREMAVGVKQKFQADVGIACSGIAGSKAVENKAIGLLFFCIIIGNKAYDFEFEMNQNNRKDNIELFTNKILESFHYLLTKLA
tmhmm (0)	-------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)	-------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	-------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (1%)	------------------------------------------------------------------------------------------------------------------------------------------------------------X
psipred	-HHHHHHHHHHH---EEEEEE-HHHHHHHHHHH------------EEE--HHHHHHHH---HHHHHH-----HHHHHHHHHHHHHH----EEEEEE-------------EEEEEEEEE--EEEEEEEE-----HHHHHHHHHHHHHHHHHHHHHH--

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    21	    0.221
  max. Y    21	    0.317
  max. S    12	    0.548
  mean S     1-20   0.408
       D     1-20   0.352    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.352 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-157	alignment	5v01B_301	1-162	0.9533	--

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
662947	Mycoplasma genitalium M2288	1 (0.04%)	1E-42	1-157	1-157	178	100	157	ref|NP_072777.1|	competence/damage inducible protein CinA [Mycoplasma genital...
1112856	Mycoplasma pneumoniae 309	1 (0.04%)	2E-40	1-157	1-157	170	54	157	ref|YP_005175492.1|	damage-inducible protein CinA-like protein [Mycoplasma pneum...
46469	Orenia marismortui	1 (0.04%)	7E-53	2-154	259-411	212	42	154	ref|WP_018247572.1|	hypothetical protein [Orenia marismortui]
439481	Aciduliprofundum boonei T469	2 (0.07%)	3E-47	3-155	4-156	193	42	154	ref|WP_008086046.1|	competence protein CinA [Aciduliprofundum boonei] gb|EDY3462...
535289	Acidovorax ebreus TPSY	1 (0.04%)	5E-29	6-103	23-120	132	41	98	ref|YP_002551827.1|	cina domain-containing protein [Acidovorax ebreus TPSY] ref|...
657309	Bacteroides xylanisolvens XB1A	1 (0.04%)	2E-52	2-154	258-410	210	40	154	ref|YP_007791283.1|	competence/damage-inducible protein cinA [Bacteroides xylani...
585544	Bacteroides sp. D22	1 (0.04%)	2E-52	2-154	258-410	210	40	154	ref|WP_008775676.1|	competence damage-inducible protein A [Bacteroides] gb|EEO55...
226186	Bacteroides thetaiotaomicron VPI-5482	1 (0.04%)	6E-52	2-154	234-386	209	40	154	ref|NP_809830.1|	competence-damage inducible protein [Bacteroides thetaiotaom...
702447	Bacteroides xylanisolvens SD CC 1b	1 (0.04%)	6E-52	2-154	258-410	209	40	154	ref|WP_004314358.1|	competence damage-inducible protein A [Bacteroides] gb|EEO49...
816	Bacteroides	1 (0.04%)	5E-52	2-154	258-410	209	40	154	ref|WP_010537995.1|	competence damage-inducible protein A [Bacteroides] emb|CDC8...
997885	Bacteroides ovatus CL02T12C04	1 (0.04%)	6E-52	2-154	258-410	209	40	154	ref|WP_004295984.1|	competence damage-inducible protein A [Bacteroides ovatus] g...
997892	Bacteroides xylanisolvens CL03T12C04	1 (0.04%)	5E-52	2-154	258-410	209	40	154	ref|WP_004312444.1|	competence damage-inducible protein A [Bacteroides] gb|EFF49...
1235785	Bacteroides thetaiotaomicron dnLKV9	1 (0.04%)	4E-52	2-154	258-410	209	40	154	ref|WP_016267576.1|	CinA-like protein [Bacteroides thetaiotaomicron] gb|EOS02053...
997886	Bacteroides ovatus CL03T12C18	1 (0.04%)	8E-52	2-154	258-410	208	40	154	ref|WP_004325927.1|	competence damage-inducible protein A [Bacteroides ovatus] g...
457390	Bacteroides sp. 3_1_23	1 (0.04%)	9E-52	2-154	258-410	208	40	154	ref|WP_008647533.1|	competence damage-inducible protein A [Bacteroides sp. 3_1_2...
665954	Bacteroides ovatus 3_8_47FAA	1 (0.04%)	7E-52	2-154	258-410	208	40	154	ref|WP_004306075.1|	competence damage-inducible protein A [Bacteroides] gb|EFS29...
469585	Bacteroides sp. 1_1_14	1 (0.04%)	3E-51	2-154	258-410	206	40	154	ref|WP_008761581.1|	competence damage-inducible protein A [Bacteroides sp. 1_1_1...
997873	Bacteroides caccae CL03T12C61	1 (0.04%)	2E-50	2-154	258-410	204	40	154	ref|WP_005675792.1|	competence damage-inducible protein A [Bacteroides] gb|EDM22...
760192	Haliscomenobacter hydrossis DSM 1100	1 (0.04%)	2E-49	2-156	259-413	200	40	156	ref|YP_004448306.1|	competence/damage-inducible protein CinA [Haliscomenobacter ...
748449	Halobacteroides halobius DSM 5150	1 (0.04%)	1E-45	2-145	259-402	188	40	145	ref|YP_007315640.1|	competence/damage-inducible protein CinA-like protein [Halob...