| Features and Secondary Structure |
| | 1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 |
| | MIKVLVIADTHGQNQRWIELKNYHNPDVIIHAGDHMTTKQFMDQNATFWVAGNNDSIGNEIEIFQLGQINFVLMHGHQAPRDNLKKWYQLLVLKAQQYPCDVLIFGHSHIEYTNKINMIQLINPGSLQLPRNQTNTPSYCTFIVNKDELTDLTIHYYQASKVS |
| tmhmm (0) | ------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| low complexity (0%) | ------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| coiled-coils (0%) | ------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| disordered (2%) | ---------------------------------------------------------------------------------------------------------------------------------------------------------------XXXX |
| psipred | --EEEEEEE----HHHHHHHHHH----EEEE------HHHHHHH--EEEEE----------EEEEE----EEE--------------HHHHHHHHHH----EEEE-----EEEEEE--EEEEE--------------EEEEEEEE--EEEEEEEEEE------ |
PSI-BLAST Sequence Hits (Top 20 by Identity) ALL DATA
|
| TaxID |
Species |
Alignments |
PSI-Blast Data (alignment with lowest E value) |
| E value |
Query Span |
Sbjct Span |
Bit Score |
Identity |
HSP Length |
Accession |
Description |
| 662945 | Mycoplasma genitalium M6320 | 1 (0.03%) | 9E-41 | 3-163 | 7-167 | 171 | 100 | 161 | ref|NP_072869.1| | serine/threonine protein phosphatase [Mycoplasma genitalium ... |
| 662946 | Mycoplasma genitalium M6282 | 1 (0.03%) | 2E-41 | 3-163 | 7-167 | 174 | 99 | 161 | ref|YP_006599744.1| | serine/threonine protein phosphatase [Mycoplasma genitalium ... |
| 1238993 | Mycoplasma pneumoniae M129-B7 | 1 (0.03%) | 1E-35 | 1-156 | 1-156 | 154 | 61 | 156 | ref|NP_109814.1| | hypothetical protein MPN126 [Mycoplasma pneumoniae M129] ref... |
| 1048830 | Mycoplasma iowae 695 | 1 (0.03%) | 7E-32 | 2-158 | 1-158 | 142 | 34 | 158 | ref|WP_004024742.1| | phosphoesterase [Mycoplasma iowae] gb|EGZ31520.1| phosphoest... |
| 272633 | Mycoplasma penetrans HF-2 | 1 (0.03%) | 3E-36 | 1-155 | 7-163 | 156 | 33 | 157 | ref|NP_757516.1| | phosphoesterase [Mycoplasma penetrans HF-2] ref|WP_011076956... |
| 593117 | Thermococcus gammatolerans EJ3 | 3 (0.1%) | 1E-23 | 2-131 | 1-140 | 115 | 33 | 144 | ref|YP_002958842.1| | metal-dependent phosphoesterase [Thermococcus gammatolerans ... |
| 1287657 | Bacillus massiliosenegalensis | 1 (0.03%) | 4E-40 | 1-161 | 1-158 | 169 | 32 | 165 | ref|WP_019154732.1| | hypothetical protein [Bacillus massiliosenegalensis] |
| 51173 | Ureibacillus thermosphaericus | 1 (0.03%) | 3E-37 | 2-146 | 1-144 | 160 | 32 | 148 | ref|WP_016837208.1| | hypothetical protein [Ureibacillus thermosphaericus] |
| 831 | Butyrivibrio fibrisolvens | 2 (0.07%) | 4E-29 | 1-156 | 1-165 | 133 | 32 | 165 | ref|WP_022752626.1| | hypothetical protein [Butyrivibrio fibrisolvens] |
| 1136178 | Geobacillus thermoglucosidans TNO-09.020 | 1 (0.03%) | 3E-41 | 2-160 | 1-156 | 173 | 31 | 163 | ref|WP_003248796.1| | metallophosphatase [Geobacillus thermoglucosidasius] gb|EID4... |
| 581103 | Geobacillus sp. Y4.1MC1 | 1 (0.03%) | 5E-41 | 2-160 | 1-156 | 172 | 31 | 163 | ref|YP_003988332.1| | phosphodiesterase [Geobacillus sp. Y4.1MC1] ref|WP_013400285... |
| 634956 | Geobacillus thermoglucosidasius C56-YS93 | 1 (0.03%) | 5E-41 | 2-160 | 1-156 | 172 | 31 | 163 | ref|YP_004587056.1| | phosphodiesterase [Geobacillus thermoglucosidasius C56-YS93]... |
| 1226325 | Clostridium sp. KLE 1755 | 1 (0.03%) | 1E-39 | 2-157 | 1-159 | 167 | 31 | 162 | ref|WP_021635409.1| | phosphodiesterase family protein [Clostridium sp. KLE 1755] ... |
| 515622 | Butyrivibrio proteoclasticus B316 | 2 (0.07%) | 2E-38 | 1-157 | 1-160 | 164 | 31 | 163 | ref|YP_003831784.1| | metallophosphoesterase [Butyrivibrio proteoclasticus B316] r... |
| 527000 | Bacillus pseudomycoides DSM 12442 | 3 (0.1%) | 5E-36 | 2-156 | 1-152 | 156 | 31 | 159 | ref|WP_003200763.1| | metallophosphatase [Bacillus] gb|EEM03856.1| phosphodiestera... |
| 1085379 | Bacillus cereus VDM006 | 1 (0.03%) | 9E-36 | 2-156 | 1-152 | 155 | 31 | 159 | ref|WP_016132080.1| | MJ0936 family phosphodiesterase [Bacillus cereus] gb|EOP6559... |
| 1085386 | Bacillus cereus VDM021 | 1 (0.03%) | 9E-36 | 2-156 | 1-152 | 155 | 31 | 159 | ref|WP_016116507.1| | MJ0936 family phosphodiesterase [Bacillus cereus] gb|EOP4982... |
| 760568 | Desulfotomaculum kuznetsovii DSM 6115 | 1 (0.03%) | 4E-34 | 2-150 | 1-151 | 149 | 31 | 155 | ref|YP_004515802.1| | phosphodiesterase, MJ0936 family [Desulfotomaculum kuznetsov... |
| 596315 | Peptostreptococcus stomatis DSM 17678 | 1 (0.03%) | 3E-32 | 2-158 | 1-156 | 143 | 31 | 163 | ref|WP_007789714.1| | phosphodiesterase [Peptostreptococcus stomatis] gb|EFM64623.... |
| 1185654 | Pyrococcus furiosus COM1 | 1 (0.03%) | 3E-31 | 2-158 | 1-160 | 140 | 31 | 169 | ref|NP_579521.1| | 5'-cyclic-nucleotide phosphodiesterase [Pyrococcus furiosus ... |