old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160
	MIKVLVIADTHGQNQRWIELKNYHNPDVIIHAGDHMTTKQFMDQNATFWVAGNNDSIGNEIEIFQLGQINFVLMHGHQAPRDNLKKWYQLLVLKAQQYPCDVLIFGHSHIEYTNKINMIQLINPGSLQLPRNQTNTPSYCTFIVNKDELTDLTIHYYQASKVS
tmhmm (0)	-------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)	-------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	-------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (2%)	---------------------------------------------------------------------------------------------------------------------------------------------------------------XXXX
psipred	--EEEEEEE----HHHHHHHHHH----EEEE------HHHHHHH--EEEEE----------EEEEE----EEE--------------HHHHHHHHHH----EEEE-----EEEEEE--EEEEE--------------EEEEEEEE--EEEEEEEEEE------

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    21	    0.107
  max. Y    18	    0.124
  max. S    16	    0.199
  mean S     1-17   0.132
       D     1-17   0.127    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.127 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-163	alignment	3ck2A_201	1-174	0.8804	HYDROLASE

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
662945	Mycoplasma genitalium M6320	1 (0.03%)	9E-41	3-163	7-167	171	100	161	ref|NP_072869.1|	serine/threonine protein phosphatase [Mycoplasma genitalium ...
662946	Mycoplasma genitalium M6282	1 (0.03%)	2E-41	3-163	7-167	174	99	161	ref|YP_006599744.1|	serine/threonine protein phosphatase [Mycoplasma genitalium ...
1238993	Mycoplasma pneumoniae M129-B7	1 (0.03%)	1E-35	1-156	1-156	154	61	156	ref|NP_109814.1|	hypothetical protein MPN126 [Mycoplasma pneumoniae M129] ref...
1048830	Mycoplasma iowae 695	1 (0.03%)	7E-32	2-158	1-158	142	34	158	ref|WP_004024742.1|	phosphoesterase [Mycoplasma iowae] gb|EGZ31520.1| phosphoest...
272633	Mycoplasma penetrans HF-2	1 (0.03%)	3E-36	1-155	7-163	156	33	157	ref|NP_757516.1|	phosphoesterase [Mycoplasma penetrans HF-2] ref|WP_011076956...
593117	Thermococcus gammatolerans EJ3	3 (0.1%)	1E-23	2-131	1-140	115	33	144	ref|YP_002958842.1|	metal-dependent phosphoesterase [Thermococcus gammatolerans ...
1287657	Bacillus massiliosenegalensis	1 (0.03%)	4E-40	1-161	1-158	169	32	165	ref|WP_019154732.1|	hypothetical protein [Bacillus massiliosenegalensis]
51173	Ureibacillus thermosphaericus	1 (0.03%)	3E-37	2-146	1-144	160	32	148	ref|WP_016837208.1|	hypothetical protein [Ureibacillus thermosphaericus]
831	Butyrivibrio fibrisolvens	2 (0.07%)	4E-29	1-156	1-165	133	32	165	ref|WP_022752626.1|	hypothetical protein [Butyrivibrio fibrisolvens]
1136178	Geobacillus thermoglucosidans TNO-09.020	1 (0.03%)	3E-41	2-160	1-156	173	31	163	ref|WP_003248796.1|	metallophosphatase [Geobacillus thermoglucosidasius] gb|EID4...
581103	Geobacillus sp. Y4.1MC1	1 (0.03%)	5E-41	2-160	1-156	172	31	163	ref|YP_003988332.1|	phosphodiesterase [Geobacillus sp. Y4.1MC1] ref|WP_013400285...
634956	Geobacillus thermoglucosidasius C56-YS93	1 (0.03%)	5E-41	2-160	1-156	172	31	163	ref|YP_004587056.1|	phosphodiesterase [Geobacillus thermoglucosidasius C56-YS93]...
1226325	Clostridium sp. KLE 1755	1 (0.03%)	1E-39	2-157	1-159	167	31	162	ref|WP_021635409.1|	phosphodiesterase family protein [Clostridium sp. KLE 1755] ...
515622	Butyrivibrio proteoclasticus B316	2 (0.07%)	2E-38	1-157	1-160	164	31	163	ref|YP_003831784.1|	metallophosphoesterase [Butyrivibrio proteoclasticus B316] r...
527000	Bacillus pseudomycoides DSM 12442	3 (0.1%)	5E-36	2-156	1-152	156	31	159	ref|WP_003200763.1|	metallophosphatase [Bacillus] gb|EEM03856.1| phosphodiestera...
1085379	Bacillus cereus VDM006	1 (0.03%)	9E-36	2-156	1-152	155	31	159	ref|WP_016132080.1|	MJ0936 family phosphodiesterase [Bacillus cereus] gb|EOP6559...
1085386	Bacillus cereus VDM021	1 (0.03%)	9E-36	2-156	1-152	155	31	159	ref|WP_016116507.1|	MJ0936 family phosphodiesterase [Bacillus cereus] gb|EOP4982...
760568	Desulfotomaculum kuznetsovii DSM 6115	1 (0.03%)	4E-34	2-150	1-151	149	31	155	ref|YP_004515802.1|	phosphodiesterase, MJ0936 family [Desulfotomaculum kuznetsov...
596315	Peptostreptococcus stomatis DSM 17678	1 (0.03%)	3E-32	2-158	1-156	143	31	163	ref|WP_007789714.1|	phosphodiesterase [Peptostreptococcus stomatis] gb|EFM64623....
1185654	Pyrococcus furiosus COM1	1 (0.03%)	3E-31	2-158	1-160	140	31	169	ref|NP_579521.1|	5'-cyclic-nucleotide phosphodiesterase [Pyrococcus furiosus ...