old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150
	MTKDHAVDIALLHLRDAHEFAPLLASYAQALKRGAPRRPDDFYAEHLLQDRAAEALGARVDGNLVGFVIFYDLPEPVTGLRAGQVDHIYVHHDHRGKGIAKALIDVLADKAEERSWSKLVLNAPRVPEDGRKLYEQIAAAADWSSYVIRFGN
tmhmm (0)	--------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)	--------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	--------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (3%)	XXXX---------------------------------------------------------------------------------------------------------------------------------------------------X
psipred	------EEEEE--HHHHHHHHHHHHHHHHHH-------HHHHHHHHHH-----EEEEEEE--EEEEEEEEEE--------------EEEE-HHH----HHHHHHHHHHHHHHH----EEEEEE----HHHHHHHHH-------EEEEEE---

# SignalP-4.0 euk predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    18	    0.118
  max. Y    18	    0.129
  max. S     5	    0.181
  mean S     1-17   0.143
       D     1-17   0.136    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.136 D-cutoff=0.450 Networks=SignalP-noTM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-152	alignment	4yfjB_306	1-155	0.7231	--

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
1328345	Brucella abortus 85-1058	1 (0.03%)	3E-34	1-152	1-152	150	100	152	ref|NP_539076.1|	acetyltransferase [Brucella melitensis bv. 1 str. 16M] ref|Y...
437663	Brucella sp. UK1/97	1 (0.03%)	3E-34	1-152	1-152	150	99	152	ref|YP_008839283.1|	Histone acetyltransferase HPA2-related acetyltransferase [Br...
693748	Brucella sp. NF 2653	1 (0.03%)	5E-34	1-152	1-152	149	99	152	ref|WP_008934912.1|	N-acetyltransferase GCN5 [Brucella] gb|EEZ31768.1| acetyltra...
1234597	Ochrobactrum intermedium M86	3 (0.07%)	1E-33	1-152	1-152	148	99	152	ref|WP_006470954.1|	N-acetyltransferase GCN5 [Ochrobactrum] gb|ELT50106.1| N-ace...
568815	Brucella microti CCM 4915	1 (0.03%)	8E-34	1-152	1-152	148	99	152	ref|YP_003107818.1|	acetyltransferase, GNAT family [Brucella microti CCM 4915] r...
1169243	Brucella suis F8/06-3	1 (0.03%)	1E-33	1-152	1-152	148	99	152	ref|YP_001628332.1|	hypothetical protein BSUIS_A1745 [Brucella suis ATCC 23445] ...
1169226	Brucella melitensis F9/05	1 (0.03%)	1E-33	1-152	1-152	148	99	152	ref|WP_006142484.1|	hypothetical protein [Brucella melitensis] gb|ENS69194.1| hy...
1198699	Brucella canis F7/05A	1 (0.03%)	2E-33	1-152	1-152	147	99	152	ref|NP_698883.1|	acetyltransferase [Brucella suis 1330] ref|YP_001593710.1| h...
520461	Brucella pinnipedialis B2/94	1 (0.03%)	4E-30	20-152	15-147	136	99	133	ref|YP_004756959.1|	GNAT family acetyltransferase [Brucella pinnipedialis B2/94]...
529	Ochrobactrum anthropi	2 (0.05%)	2E-33	1-152	1-152	147	98	152	ref|YP_001369500.1|	N-acetyltransferase GCN5 [Ochrobactrum anthropi ATCC 49188] ...
314231	Fulvimarina pelagi HTCC2506	2 (0.05%)	2E-32	2-152	8-158	144	58	151	ref|WP_007066160.1|	N-acetyltransferase GCN5 [Fulvimarina pelagi] gb|EAU40574.1|...
744980	Roseibium sp. TrichSKD4	2 (0.05%)	2E-32	5-150	2-147	144	47	146	ref|WP_009467296.1|	N-acetyltransferase GCN5 [Roseibium sp. TrichSKD4] gb|EFO323...
911045	Pseudovibrio sp. FO-BEG1	1 (0.03%)	6E-29	6-150	3-147	132	41	145	ref|YP_005078774.1|	acetyltransferase, GNAT family [Pseudovibrio sp. FO-BEG1] re...
318586	Paracoccus denitrificans PD1222	2 (0.05%)	1E-21	23-150	1-132	108	36	132	ref|YP_915256.1|	N-acetyltransferase [Paracoccus denitrificans PD1222] ref|WP...
1150469	Rhodospirillum photometricum DSM 122	1 (0.03%)	6E-24	5-150	2-148	116	33	147	ref|YP_005416102.1|	N-acetyltransferase GCN5 [Rhodospirillum photometricum DSM 1...
557760	Rhodobacter sphaeroides KD131	3 (0.07%)	1E-25	8-151	6-152	121	32	147	ref|YP_002524587.1|	N-acetyltransferase GCN5 [Rhodobacter sphaeroides KD131] ref...
1223523	Streptomyces mobaraensis NBRC 13819 = DSM 40847	2 (0.05%)	9E-37	7-150	2-144	158	29	144	ref|WP_004953750.1|	N-acetyltransferase GCN5 [Streptomyces mobaraensis] gb|EME96...
441620	Methylobacterium populi BJ001	4 (0.1%)	8E-15	71-150	5-84	86	29	80	ref|YP_001925726.1|	N-acetyltransferase GCN5 [Methylobacterium populi BJ001] ref...
1951	Streptomyces purpureus	1 (0.03%)	6E-35	7-150	2-144	152	28	144	ref|WP_019890292.1|	hypothetical protein [Streptomyces purpureus]
189	Novispirillum itersonii	1 (0.03%)	2E-32	1-150	21-171	144	28	151	ref|WP_019644148.1|	hypothetical protein [Novispirillum itersonii]