old.robetta.org

A new Robetta server is available for structure prediction.

This service will be discontinued at the end of April 2026

     
Fragment Libraries    Alanine Scanning    DNA Interface Scan
[ Queue ] [ Submit ]    [ Queue ] [ Submit ]    [ Queue ] [ Submit ]
[ Register / Update ] [ Docs / FAQs ] [ Login ]


     
Job 81919 [SSGCID - BuamA.00098.a] [2018-03-05] [D-172-16-30-137.dhcp4.x.x] [Structure] [Complete] Molybdopterin biosynthesis MoaE protein - BATCH:81918

Full Structure Predictions  
Model 1

 chemical/x-pdb  MIME type  PDB file
Model 2

 chemical/x-pdb  MIME type  PDB file
Model 3

 chemical/x-pdb  MIME type  PDB file
Model 4

 chemical/x-pdb  MIME type  PDB file
Model 5

 chemical/x-pdb  MIME type  PDB file

Click the icons below each image to download the prediction in PDB format ( PDB file )

Images were produced using MolScript and Raster3D!




Plots powered by Plotly.js.

Features and Secondary Structure  
 
1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .
 
MATIRIQTDDFDLNAEVAALRARNPKIGALACFVGTVRDLNEGDSVAAMELEHYPGMTEKALEKIAAEAGRRWPGIDVAIVHRVGRLLPLDQIVMVATVASHRGDAFASCEFVMDYLKTEAPFWKKETTPDGERWVDARSTDDAALARWGVESGNTPR
tmhmm (0)
--------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)
--------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)
--------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (11%)
X---------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXXXXXXXXX
psipred
--EEEEEE----HHHHHHHHH-------EEEEEEEEE--------EEEEEEEE--HHHHHHHHHHHHHHHHH----EEEEEEE--------EEEEEEEE---HHHHHHHHHHHHHHHHH---EEEEEE-----EEE------HHHHHH----------

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    48	    0.161
  max. Y    48	    0.157
  max. S    28	    0.241
  mean S     1-47   0.122
       D     1-47   0.144    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.144 D-cutoff=0.450 Networks=SignalP-TM


Domain Repeats Prediction     Top
  Boundary     STD (+/-)     Consensus  
------


Ginzu Domain Prediction 1       Top
Domain Span Source Reference Parent   Parent Span     Confidence     Annotations  
  1-158     alignment     1fm0E_201     1-142   0.8249   TRANSFERASE


PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA       Top
TaxID Species Alignments PSI-Blast Data (alignment with lowest E value)
E value Query Span Sbjct Span Bit Score Identity HSP Length Accession Description
398577Burkholderia ambifaria MC40-62 (0.08%)5E-591-1581-158232100158ref|YP_001808461.1|molybdopterin biosynthesis MoaE protein [Burkholderia ambifa...
396596Burkholderia ambifaria IOP40-102 (0.08%)1E-581-1581-15823199158ref|WP_006755405.1|molybdenum cofactor biosynthesis protein MoaE [Burkholderia ...
331272Burkholderia cenocepacia HI24241 (0.04%)1E-581-1581-15823198158ref|YP_626066.1|molybdopterin biosynthesis MoaE [Burkholderia cenocepacia AU...
339670Burkholderia ambifaria AMMD1 (0.04%)2E-571-1581-15822798158ref|YP_773678.1|molybdopterin biosynthesis MoaE [Burkholderia ambifaria AMMD...
1009846Burkholderia cepacia GG41 (0.04%)3E-591-1581-15823397158ref|YP_006615693.1|molybdopterin biosynthesis protein MoaE [Burkholderia cepaci...
396597Burkholderia ambifaria MEX-52 (0.08%)2E-581-1581-15823097158ref|WP_006758353.1|molybdenum cofactor biosynthesis protein MoaE [Burkholderia ...
1335308Burkholderia vietnamiensis AU4i2 (0.08%)1E-571-1581-15822897158ref|WP_021156501.1|Molybdenum cofactor biosynthesis protein MoaE [Burkholderia ...
1055524Burkholderia cenocepacia H1112 (0.08%)2E-571-1581-15822797158ref|YP_002231050.1|molybdopterin converting factor subunit 2 [Burkholderia ceno...
350702Burkholderia cenocepacia PC1842 (0.08%)2E-571-1581-15822797158ref|WP_006478643.1|molybdenum cofactor biosynthesis protein MoaE [Burkholderia ...
95486Burkholderia cenocepacia1 (0.04%)2E-571-1581-15822797158ref|WP_023476849.1|Molybdenum cofactor biosynthesis protein MoaE [Burkholderia ...
482957Burkholderia lata2 (0.08%)1E-571-1581-15822896158ref|YP_369389.1|molybdopterin synthase subunit MoaE [Burkholderia lata] ref|...
406425Burkholderia cenocepacia MC0-32 (0.08%)2E-571-1581-15822796158ref|YP_001765157.1|molybdopterin biosynthesis MoaE protein [Burkholderia cenoce...
416344Burkholderia sp. KJ0061 (0.04%)1E-581-1581-15823194158ref|YP_001119616.1|molybdopterin synthase subunit MoaE [Burkholderia vietnamien...
987057Burkholderia sp. TJI492 (0.08%)8E-581-1581-15822894158gb|EGC98944.1|molybdopterin synthase subunit MoaE [Burkholderia sp. TJI49]
513051Burkholderia multivorans CGD12 (0.08%)2E-571-1581-15822792158ref|WP_006402319.1|molybdenum cofactor biosynthesis protein MoaE [Burkholderia ...
101571Burkholderia ubonensis2 (0.08%)6E-591-1581-15823291158ref|WP_010092215.1|molybdenum cofactor biosynthesis protein MoaE [Burkholderia ...
985078Burkholderia multivorans CF22 (0.08%)2E-571-1582-15922791158ref|WP_006415335.1|molybdenum cofactor biosynthesis protein MoaE [Burkholderia ...
395019Burkholderia multivorans ATCC 176162 (0.08%)3E-571-1581-15822691158ref|YP_001579608.1|molybdopterin biosynthesis MoaE protein [Burkholderia multiv...
985079Burkholderia multivorans ATCC BAA-2472 (0.08%)4E-571-1581-15822691158ref|WP_006407806.1|molybdenum cofactor biosynthesis protein MoaE [Burkholderia ...
350701Burkholderia dolosa AUO1581 (0.04%)8E-571-1581-15822491158ref|WP_006764182.1|molybdenum cofactor biosynthesis protein MoaE [Burkholderia ...






Robetta is available for NON-COMMERCIAL USE ONLY at this time
[ Terms of Service ]
Copyright © 2004-2011 University of Washington