old.robetta.org

A new Robetta server is available for structure prediction.

     
Fragment Libraries    Alanine Scanning    DNA Interface Scan
[ Queue ] [ Submit ]    [ Queue ] [ Submit ]    [ Queue ] [ Submit ]
[ Register / Update ] [ Docs / FAQs ] [ Login ]


     
Job 81925 [SSGCID - EnhiA.01283.a] [2018-03-05] [D-172-16-30-137.dhcp4.x.x] [Structure] [Complete] HAD hydrolase, family IA, variant 3 - BATCH:81918

Full Structure Predictions  
Model 1

 chemical/x-pdb  MIME type  PDB file
Model 2

 chemical/x-pdb  MIME type  PDB file
Model 3

 chemical/x-pdb  MIME type  PDB file
Model 4

 chemical/x-pdb  MIME type  PDB file
Model 5

 chemical/x-pdb  MIME type  PDB file

Click the icons below each image to download the prediction in PDB format ( PDB file )

Images were produced using MolScript and Raster3D!




Plots powered by Plotly.js.

Features and Secondary Structure  
 
1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220 
 
MEAVLFDFNGTLIFDTPLHAFCWKEMAKRIRGTPLSEDEFKLLNGRTNKQLIEHILNKEISDEDAKKYAEEKENLYRTMLMKSDIKLCDGAINLFEALKKCNIPFTIATSSDWGNVQVFIQKYHLEEWFDIDKIIFNDFTFKGKPAPDIYLKASKKLGVSISHCIVFEDTISGIHSALSAGATPIGIASEMTVNELLQIKGCNLAIHTFNEITIEEMVDLIKNK
tmhmm (0)
--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (5%)
-------------------------------------------------------------XXXXXXXXXXXX-------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)
--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (1%)
------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XX
psipred
-EEEEE-----HH--HHHHHHHHHHHHHH-------HHHHHH-----HHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHH---------HHHHHHHHHH----EEEEE---HHHHHHHHHH---HHH----EEEEHHH-------HHHHHHHHHHH---HHHEEEE---HHHHHHHHH---EEEEE-----HHHHHHH----EEE---HH--HHHHHHHHH--

# SignalP-4.0 euk predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    21	    0.146
  max. Y    21	    0.141
  max. S     8	    0.184
  mean S     1-20   0.137
       D     1-20   0.139    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.139 D-cutoff=0.450 Networks=SignalP-noTM


Domain Repeats Prediction     Top
  Boundary     STD (+/-)     Consensus  
------


Ginzu Domain Prediction 1       Top
Domain Span Source Reference Parent   Parent Span     Confidence     Annotations  
  1-224     alignment     3fm9A_202     1-220   0.6935   ISOMERASE


PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA       Top
TaxID Species Alignments PSI-Blast Data (alignment with lowest E value)
E value Query Span Sbjct Span Bit Score Identity HSP Length Accession Description
885318Entamoeba histolytica HM-1:IMSS-A1 (0.03%)7E-601-2241-224236100224ref|XP_656689.1|HAD hydrolase, family IA, variant 3 [Entamoeba histolytica H...
1076696Entamoeba nuttalli P191 (0.03%)2E-591-2241-22423598224gb|EKE37241.1|HAD hydrolase, family IA, variant 3, putative [Entamoeba nut...
370354Entamoeba dispar SAW7604 (0.1%)4E-591-2241-22423495224ref|XP_001736355.1|2-deoxyglucose-6-phosphate phosphatase [Entamoeba dispar SAW...
370355Entamoeba invadens IP11 (0.03%)2E-511-2221-22220845222ref|XP_004256007.1|2-deoxyglucose-6-phosphate phosphatase, putative [Entamoeba ...
412133Trichomonas vaginalis G321 (0.53%)3E-461-2131-21619145216ref|XP_001583024.1|haloacid dehalogenase-like hydrolase family protein [Trichom...
1227268Leptotrichia sp. oral taxon 879 str. F05571 (0.03%)1E-481-2173-22319939221ref|WP_021743192.1|HAD hydrolase, family IA, variant 3 [Leptotrichia sp. oral t...
634994Leptotrichia hofstadii F02541 (0.03%)7E-481-2173-22319639221ref|WP_006803676.1|HAD family hydrolase [Leptotrichia hofstadii] gb|EEX75741.1|...
1149861Pelosinus fermentans B31 (0.03%)8E-433-2127-22017939214ref|WP_007935049.1|hydrolase [Pelosinus] gb|EIW17739.1| HAD-superfamily hydrola...
428126Clostridium spiroforme DSM 15521 (0.03%)9E-412-2164-21517238219ref|WP_004609366.1|hypothetical protein [[Clostridium] spiroforme] gb|EDS75659....
1139996Enterococcus saccharolyticus ATCC 430764 (0.1%)2E-471-2221-22119535224ref|WP_016175935.1|hypothetical protein [Enterococcus saccharolyticus] gb|EOT26...
526218Sebaldella termitidis ATCC 333863 (0.07%)9E-421-2193-22617635226ref|YP_003309458.1|HAD-superfamily hydrolase [Sebaldella termitidis ATCC 33386]...
1139219Enterococcus dispar ATCC 512662 (0.05%)2E-451-2211-22418833224ref|WP_016172880.1|hypothetical protein [Enterococcus dispar] gb|EOT40799.1| hy...
1196322Clostridium sp. Maddingley MBC34-264 (0.1%)4E-571-2121-20722732212ref|WP_008420656.1|haloacid dehalogenase superfamily enzyme, subfamily IA [Clos...
1185876Fibrisoma limi BUZ 35 (0.12%)6E-533-2217-22121332220ref|WP_009280977.1|haloacid dehalogenase [Fibrisoma limi] emb|CCH52393.1| HAD-s...
70993Flexithrix dorotheae1 (0.03%)2E-503-2215-21720532220ref|WP_020527207.1|hypothetical protein [Flexithrix dorotheae]
1278073Myxococcus stipitatus DSM 146751 (0.03%)3E-491-2218-22420132221ref|YP_007360101.1|HAD family hydrolase [Myxococcus stipitatus DSM 14675] ref|W...
497965Cyanothece sp. PCC 78224 (0.1%)2E-473-2194-21419432217ref|YP_003888812.1|HAD-superfamily hydrolase [Cyanothece sp. PCC 7822] ref|WP_0...
1249483Leptospira yanagawae serovar Saopaulo str. Sao Paulo = ATCC 7005231 (0.03%)2E-462-2114-20719132211ref|WP_015677289.1|beta-phosphoglucomutase family hydrolase [Leptospira yanagaw...
456481Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'1 (0.03%)1E-442-2114-20718532211ref|YP_001837518.1|putative beta-phosphoglucomutase [Leptospira biflexa serovar...
1121101Bacteroides salyersiae WAL 10018 = DSM 18765 = JCM 129881 (0.03%)5E-443-2135-21318332213ref|WP_005933205.1|HAD hydrolase, family IA [Bacteroides salyersiae] gb|EOA4807...






Robetta is available for NON-COMMERCIAL USE ONLY at this time
[ Terms of Service ]
Copyright © 2004-2011 University of Washington