old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 .
	MSKTPLSIAHPWHGPVLTRDDYESLCCYIEITPADSVKFELDKETGILKVDRPQKFSNFCPCLYGLLPKTYCGDLSGEYSGQQSNRENIKGDGDPLDICVLTEKNITQGNILLQARPIGGIRILDSEEADDKIIAVLEDDLVYGNIEDISECPGTVLDMIQHYFLTYKATPESLIQAKPAKIEIVGLYGKKEAQKVIRLAHEDYCNLFM
tmhmm (0)	-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)	-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (3%)	XXXX-X-X---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
psipred	-----------------------EEEEEEEE------EEEE------EEEEEE--------------------------------------------EEEEE-------EEEEEEEEEEEEEE--------EEEEE----HHHHH---HHH--HHHHHHHHHHHHHH-------------EEEE-----HHHHHHHHHHHHHHHHHH--

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    12	    0.107
  max. Y     3	    0.152
  max. S     1	    0.232
  mean S     1-2    0.225
       D     1-2    0.181    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.181 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-209	alignment	5wrtA_302	1-235	0.7751	--

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
1100833	Chlamydia trachomatis F/SWFPminus	1 (0.04%)	4E-61	1-209	1-209	240	100	209	ref|NP_220291.1|	Inorganic Pyrophosphatase [Chlamydia trachomatis D/UW-3/CX] ...
243161	Chlamydia muridarum str. Nigg	1 (0.04%)	3E-61	1-209	1-209	240	95	209	ref|NP_296532.1|	inorganic pyrophosphatase, putative [Chlamydia muridarum str...
264202	Chlamydophila felis Fe/C-56	1 (0.04%)	2E-60	1-208	1-209	238	84	209	ref|YP_515082.1|	inorganic pyrophosphatase [Chlamydophila felis Fe/C-56] ref|...
1003238	Chlamydophila abortus LLG	1 (0.04%)	3E-61	3-209	4-210	240	82	207	ref|WP_006344423.1|	inorganic pyrophosphatase [Chlamydophila abortus] gb|EGK6955...
218497	Chlamydophila abortus S26/3	1 (0.04%)	3E-60	3-209	4-210	237	82	207	ref|YP_220206.1|	inorganic pyrophosphatase [Chlamydophila abortus S26/3] ref|...
227941	Chlamydophila caviae GPIC	1 (0.04%)	3E-59	1-208	1-209	234	82	209	ref|NP_829714.1|	inorganic pyrophosphatase [Chlamydophila caviae GPIC] ref|WP...
1238235	Chlamydia psittaci 10_881_SC42	1 (0.04%)	7E-59	1-208	1-208	232	82	208	ref|WP_020356534.1|	inorganic pyrophosphatase family protein [Chlamydia psittaci...
1112249	Chlamydia psittaci C6/98	1 (0.04%)	2E-57	9-209	1-201	228	82	201	ref|YP_005663530.1|	inorganic pyrophosphatase [Chlamydia psittaci 6BC] ref|WP_01...
1238237	Chlamydia psittaci 10_1398_11	1 (0.04%)	2E-60	1-208	1-209	238	81	209	ref|WP_020370549.1|	soluble inorganic pyrophosphatase 2 [Chlamydia] gb|EPP34807....
1218357	Chlamydia psittaci M56	1 (0.04%)	2E-59	1-209	1-210	235	81	210	ref|YP_006737767.1|	inorganic pyrophosphatase family protein [Chlamydia psittaci...
1112248	Chlamydia psittaci C1/97	1 (0.04%)	4E-59	1-209	1-210	233	81	210	ref|YP_004422668.1|	inorganic pyrophosphatase [Chlamydia psittaci 6BC] ref|YP_00...
182082	Chlamydophila pneumoniae TW-183	1 (0.04%)	3E-60	1-208	1-208	237	80	208	ref|NP_225113.1|	inorganic pyrophosphatase [Chlamydophila pneumoniae CWL029] ...
406984	Chlamydophila pneumoniae LPCoLN	1 (0.04%)	7E-60	1-208	1-208	236	80	208	ref|YP_005662514.1|	inorganic pyrophosphatase [Chlamydophila pneumoniae LPCoLN] ...
1218358	Chlamydia psittaci WC	1 (0.04%)	7E-59	1-209	1-210	233	80	210	ref|YP_006738810.1|	inorganic pyrophosphatase family protein [Chlamydia psittaci...
1050221	Chlamydia psittaci NJ1	1 (0.04%)	2E-58	1-209	1-210	231	80	210	ref|YP_006740973.1|	inorganic pyrophosphatase family protein [Chlamydia psittaci...
1234369	Chlamydia pecorum P787	1 (0.04%)	6E-59	1-208	1-208	233	77	208	ref|YP_004376844.1|	inorganic pyrophosphatase [Chlamydophila pecorum E58] ref|YP...
742817	Odoribacter laneus YIT 12061	1 (0.04%)	2E-58	7-208	17-215	231	54	202	ref|WP_009137784.1|	inorganic pyrophosphatase [Odoribacter] gb|EHP45668.1| hypot...
1201288	Bacteriovorax sp. Seq25_V	1 (0.04%)	2E-54	10-208	20-216	218	54	200	ref|WP_021275628.1|	inorganic diphosphatase [Bacteriovorax sp. Seq25_V] gb|EQC44...
709991	Odoribacter splanchnicus DSM 220712	1 (0.04%)	4E-60	7-208	17-215	236	53	202	ref|YP_004253445.1|	Inorganic diphosphatase [Odoribacter splanchnicus DSM 220712...
544644	Butyricimonas synergistica	1 (0.04%)	2E-59	7-208	17-213	234	53	202	ref|WP_018337647.1|	inorganic pyrophosphatase [Butyricimonas synergistica]