old.robetta.org

A new Robetta server is available for structure prediction.

This service will be discontinued at the end of April 2026

     
Fragment Libraries    Alanine Scanning    DNA Interface Scan
[ Queue ] [ Submit ]    [ Queue ] [ Submit ]    [ Queue ] [ Submit ]
[ Register / Update ] [ Docs / FAQs ] [ Login ]


     
Job 82016 [SSGCID - ChtrB.01427.a] [2018-03-09] [D-172-16-30-137.dhcp4.x.x] [Structure] [Complete] Inorganic pyrophosphatase (EC 3.6.1.1) (Pyrophosphate phospho-hydrolase) (PPase) - BATCH:82003

Full Structure Predictions  
Model 1

 chemical/x-pdb  MIME type  PDB file
Model 2

 chemical/x-pdb  MIME type  PDB file
Model 3

 chemical/x-pdb  MIME type  PDB file
Model 4

 chemical/x-pdb  MIME type  PDB file
Model 5

 chemical/x-pdb  MIME type  PDB file

Click the icons below each image to download the prediction in PDB format ( PDB file )

Images were produced using MolScript and Raster3D!




Plots powered by Plotly.js.

Features and Secondary Structure  
 
1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    . 
 
MSKTPLSIAHPWHGPVLTRDDYESLCCYIEITPADSVKFELDKETGILKVDRPQKFSNFCPCLYGLLPKTYCGDLSGEYSGQQSNRENIKGDGDPLDICVLTEKNITQGNILLQARPIGGIRILDSEEADDKIIAVLEDDLVYGNIEDISECPGTVLDMIQHYFLTYKATPESLIQAKPAKIEIVGLYGKKEAQKVIRLAHEDYCNLFM
tmhmm (0)
-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)
-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)
-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (3%)
XXXX-X-X---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
psipred
-----------------------EEEEEEEE------EEEE------EEEEEE--------------------------------------------EEEEE-------EEEEEEEEEEEEEE--------EEEEE----HHHHH---HHH--HHHHHHHHHHHHHH-------------EEEE-----HHHHHHHHHHHHHHHHHH--

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    12	    0.107
  max. Y     3	    0.152
  max. S     1	    0.232
  mean S     1-2    0.225
       D     1-2    0.181    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.181 D-cutoff=0.450 Networks=SignalP-TM


Domain Repeats Prediction     Top
  Boundary     STD (+/-)     Consensus  
------


Ginzu Domain Prediction 1       Top
Domain Span Source Reference Parent   Parent Span     Confidence     Annotations  
  1-209     alignment     5wrtA_302     1-235   0.7751   --


PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA       Top
TaxID Species Alignments PSI-Blast Data (alignment with lowest E value)
E value Query Span Sbjct Span Bit Score Identity HSP Length Accession Description
1100833Chlamydia trachomatis F/SWFPminus1 (0.04%)4E-611-2091-209240100209ref|NP_220291.1|Inorganic Pyrophosphatase [Chlamydia trachomatis D/UW-3/CX] ...
243161Chlamydia muridarum str. Nigg1 (0.04%)3E-611-2091-20924095209ref|NP_296532.1|inorganic pyrophosphatase, putative [Chlamydia muridarum str...
264202Chlamydophila felis Fe/C-561 (0.04%)2E-601-2081-20923884209ref|YP_515082.1|inorganic pyrophosphatase [Chlamydophila felis Fe/C-56] ref|...
1003238Chlamydophila abortus LLG1 (0.04%)3E-613-2094-21024082207ref|WP_006344423.1|inorganic pyrophosphatase [Chlamydophila abortus] gb|EGK6955...
218497Chlamydophila abortus S26/31 (0.04%)3E-603-2094-21023782207ref|YP_220206.1|inorganic pyrophosphatase [Chlamydophila abortus S26/3] ref|...
227941Chlamydophila caviae GPIC1 (0.04%)3E-591-2081-20923482209ref|NP_829714.1|inorganic pyrophosphatase [Chlamydophila caviae GPIC] ref|WP...
1238235Chlamydia psittaci 10_881_SC421 (0.04%)7E-591-2081-20823282208ref|WP_020356534.1|inorganic pyrophosphatase family protein [Chlamydia psittaci...
1112249Chlamydia psittaci C6/981 (0.04%)2E-579-2091-20122882201ref|YP_005663530.1|inorganic pyrophosphatase [Chlamydia psittaci 6BC] ref|WP_01...
1238237Chlamydia psittaci 10_1398_111 (0.04%)2E-601-2081-20923881209ref|WP_020370549.1|soluble inorganic pyrophosphatase 2 [Chlamydia] gb|EPP34807....
1218357Chlamydia psittaci M561 (0.04%)2E-591-2091-21023581210ref|YP_006737767.1|inorganic pyrophosphatase family protein [Chlamydia psittaci...
1112248Chlamydia psittaci C1/971 (0.04%)4E-591-2091-21023381210ref|YP_004422668.1|inorganic pyrophosphatase [Chlamydia psittaci 6BC] ref|YP_00...
182082Chlamydophila pneumoniae TW-1831 (0.04%)3E-601-2081-20823780208ref|NP_225113.1|inorganic pyrophosphatase [Chlamydophila pneumoniae CWL029] ...
406984Chlamydophila pneumoniae LPCoLN1 (0.04%)7E-601-2081-20823680208ref|YP_005662514.1|inorganic pyrophosphatase [Chlamydophila pneumoniae LPCoLN] ...
1218358Chlamydia psittaci WC1 (0.04%)7E-591-2091-21023380210ref|YP_006738810.1|inorganic pyrophosphatase family protein [Chlamydia psittaci...
1050221Chlamydia psittaci NJ11 (0.04%)2E-581-2091-21023180210ref|YP_006740973.1|inorganic pyrophosphatase family protein [Chlamydia psittaci...
1234369Chlamydia pecorum P7871 (0.04%)6E-591-2081-20823377208ref|YP_004376844.1|inorganic pyrophosphatase [Chlamydophila pecorum E58] ref|YP...
742817Odoribacter laneus YIT 120611 (0.04%)2E-587-20817-21523154202ref|WP_009137784.1|inorganic pyrophosphatase [Odoribacter] gb|EHP45668.1| hypot...
1201288Bacteriovorax sp. Seq25_V1 (0.04%)2E-5410-20820-21621854200ref|WP_021275628.1|inorganic diphosphatase [Bacteriovorax sp. Seq25_V] gb|EQC44...
709991Odoribacter splanchnicus DSM 2207121 (0.04%)4E-607-20817-21523653202ref|YP_004253445.1|Inorganic diphosphatase [Odoribacter splanchnicus DSM 220712...
544644Butyricimonas synergistica1 (0.04%)2E-597-20817-21323453202ref|WP_018337647.1|inorganic pyrophosphatase [Butyricimonas synergistica]






Robetta is available for NON-COMMERCIAL USE ONLY at this time
[ Terms of Service ]
Copyright © 2004-2011 University of Washington