old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 .
	MVKLVVGIGNPGRQYVWTRHNIGFLLLDSLASRFLGAFREAPRLYASFAKVEISSEAVVLMKPTTYVNLTGKAVLAAKKFFDVSMEDILVVADDINREFGFVRFRQDCGSGGHNGIKNTTQILQSNHYWQLRLGVGRPSYPGAEGVADYVLSSFSLNEKEKLNDFLEKGIEEILPWLGC
tmhmm (0)	-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)	-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (1%)	------------------------------------------------------------------------------------------------------------X----------------------------------------------------------------------
psipred	-EEEEEE-----HHH--------HHHHHHHHHHH-----------EEEEEEEE--EEEEE-------------HHHHHHH----HHHEEEEEEE-------EEEE----------HHHHHHH-----EEEEEEEE--------------------HHHHHHHHHHHHHHHHHHHHHH--

# SignalP-4.0 euk predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    38	    0.138
  max. Y    38	    0.190
  max. S    31	    0.529
  mean S     1-37   0.219
       D     1-37   0.206    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.206 D-cutoff=0.450 Networks=SignalP-noTM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-179	alignment	4qt4A_201	1-189	0.9539	--

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
707183	Chlamydia trachomatis E/11023	1 (0.04%)	4E-59	1-179	1-179	232	99	179	ref|YP_005810041.1|	peptidyl-tRNA hydrolase [Chlamydia trachomatis E/11023] ref|...
907269	Chlamydia trachomatis RC-F(s)/342	1 (0.04%)	4E-59	1-179	1-179	232	99	179	ref|YP_008345809.1|	peptidyl-tRNA hydrolase [Chlamydia trachomatis RC-F(s)/852] ...
1071782	Chlamydia trachomatis L2b/Ams5	1 (0.04%)	1E-58	1-179	1-179	231	99	179	ref|YP_001653272.1|	peptidyl-tRNA hydrolase [Chlamydia trachomatis L2b/UCH-1/pro...
1100832	Chlamydia trachomatis E/C599	1 (0.04%)	1E-58	1-179	1-179	231	99	179	ref|YP_005814634.1|	peptidyl-tRNA hydrolase [Chlamydia trachomatis E/150] ref|YP...
813	Chlamydia trachomatis	1 (0.04%)	2E-58	1-179	1-179	230	99	179	ref|YP_007736120.1|	peptidyl-tRNA hydrolase [Chlamydia trachomatis Ia/SotonIa1] ...
406984	Chlamydophila pneumoniae LPCoLN	1 (0.04%)	6E-50	1-176	1-176	202	49	177	ref|YP_005662477.1|	peptidyl-tRNA hydrolase [Chlamydophila pneumoniae LPCoLN] re...
81464	Anaeromusa acidaminophila	1 (0.04%)	4E-66	2-177	1-172	256	44	176	ref|WP_018702849.1|	hypothetical protein [Anaeromusa acidaminophila]
443218	Amycolicicoccus subflavus DQS3-9A1	1 (0.04%)	2E-62	1-172	1-170	243	44	172	ref|YP_004494728.1|	peptidyl-tRNA hydrolase [Amycolicicoccus subflavus DQS3-9A1]...
379896	Paenibacillus fonticola	1 (0.04%)	9E-68	2-174	1-170	261	42	173	ref|WP_019640025.1|	peptidyl-tRNA hydrolase [Paenibacillus fonticola]
768706	Desulfosporosinus orientis DSM 765	1 (0.04%)	1E-64	2-177	1-172	250	42	176	ref|YP_004968333.1|	peptidyl-tRNA hydrolase [Desulfosporosinus orientis DSM 765]...
1219013	Rhodococcus equi NBRC 101255 = C 7	1 (0.04%)	8E-60	5-177	10-180	235	42	173	ref|WP_005514714.1|	peptidyl-tRNA hydrolase [Rhodococcus equi] gb|EGD22488.1| am...
685727	Rhodococcus equi 103S	1 (0.04%)	1E-59	5-177	10-180	234	42	173	ref|YP_004006023.1|	aminoacyl-tRNA hydrolase pth [Rhodococcus equi 103S] ref|WP_...
46469	Orenia marismortui	1 (0.04%)	8E-69	2-178	1-173	265	41	177	ref|WP_018248276.1|	hypothetical protein [Orenia marismortui]
138119	Desulfitobacterium hafniense Y51	1 (0.04%)	5E-68	2-176	12-182	262	41	175	ref|YP_516412.1|	peptidyl-tRNA hydrolase [Desulfitobacterium hafniense Y51] r...
1278076	Rhodococcus ruber BKS 20-38	1 (0.04%)	1E-67	4-177	7-178	261	41	174	ref|WP_003937848.1|	peptidyl-tRNA hydrolase [Rhodococcus ruber] gb|EME61900.1| p...
871963	Desulfitobacterium dichloroeliminans LMG P-21439	1 (0.04%)	9E-68	2-176	1-171	261	41	175	ref|YP_007219027.1|	peptidyl-tRNA hydrolase [Desulfitobacterium dichloroeliminan...
49338	Desulfitobacterium hafniense	1 (0.04%)	9E-68	2-176	12-182	261	41	175	ref|WP_018211848.1|	peptidyl-tRNA hydrolase [Desulfitobacterium hafniense]
537010	Desulfitobacterium hafniense DP7	1 (0.04%)	1E-67	2-176	1-171	260	41	175	ref|YP_002456624.1|	peptidyl-tRNA hydrolase [Desulfitobacterium hafniense DCB-2]...
756499	Desulfitobacterium dehalogenans ATCC 51507	1 (0.04%)	4E-67	2-176	1-171	259	41	175	ref|YP_006428383.1|	peptidyl-tRNA hydrolase [Desulfitobacterium dehalogenans ATC...
686340	Methylomicrobium album BG8	1 (0.04%)	1E-65	1-177	1-175	254	41	177	ref|WP_005374001.1|	peptidyl-tRNA hydrolase [Methylomicrobium album] gb|EIC30996...