| Features and Secondary Structure |
| | 1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 |
| | MALNLRINRQIRAPRVRVIGSAGEQLGILSIKEALDLAKEANLDLVEVASNSEPPVCKIMDYGKYRYDVTKKEKDSKKAQHQVRIKEVKLKPNIDDNDFLTKAKQARAFIEKGNKVKVSCMFRGRELAYPEHGYKVIQRMCQGLEDIGFVESEPKLNGRSLICVIAPGTLKTKKK |
| tmhmm (0) | ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| low complexity (0%) | ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| coiled-coils (0%) | ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| disordered (18%) | XXX--------------------------------------------------------------XXXXXXXXXXXXXXXXXX---------------------------------------------------------------------------------XXXXXXXXXXX |
| psipred | --------------EEEEE--------EEEHHHHHHHHHHH---EEEE-------EEEEE-HHHHHHHHHHHHHHHHH--------EEEE-------HHHHHHHHHHHHHH---EEEEEEEE-------HHHHHHHHHHHHHHH---EEEEE-------EEEEEEEE-------- |
PSI-BLAST Sequence Hits (Top 20 by Identity) ALL DATA
|
| TaxID |
Species |
Alignments |
PSI-Blast Data (alignment with lowest E value) |
| E value |
Query Span |
Sbjct Span |
Bit Score |
Identity |
HSP Length |
Accession |
Description |
| 1071765 | Chlamydia trachomatis G/SotonG1 | 1 (0.04%) | 2E-56 | 1-175 | 1-175 | 223 | 100 | 175 | ref|NP_220354.1| | Initiation Factor 3 [Chlamydia trachomatis D/UW-3/CX] ref|YP... |
| 813 | Chlamydia trachomatis | 3 (0.11%) | 7E-60 | 1-175 | 84-258 | 235 | 99 | 175 | ref|YP_005808226.1| | translation initiation factor IF-3 [Chlamydia trachomatis G/... |
| 1100833 | Chlamydia trachomatis F/SWFPminus | 1 (0.04%) | 5E-56 | 1-175 | 1-175 | 222 | 99 | 175 | ref|YP_005816470.1| | protein translation initiation factor 3 (IF-3) [Chlamydia tr... |
| 1071767 | Chlamydia trachomatis Ia/SotonIa3 | 1 (0.04%) | 2E-55 | 1-175 | 1-175 | 220 | 99 | 175 | ref|YP_007736155.1| | translation initiation factor IF-3 [Chlamydia trachomatis Ia... |
| 580047 | Chlamydia trachomatis A2497 | 1 (0.04%) | 9E-57 | 1-175 | 24-198 | 224 | 98 | 175 | ref|YP_005813737.1| | Bacterial Protein Translation Initiation Factor 3 (IF-3) [Ch... |
| 1007870 | Chlamydia trachomatis RC-L2/55 | 1 (0.04%) | 6E-55 | 1-175 | 1-175 | 219 | 98 | 175 | ref|YP_001654295.1| | translation initiation factor IF-3 [Chlamydia trachomatis 43... |
| 1071753 | Chlamydia trachomatis A/363 | 1 (0.04%) | 1E-54 | 1-175 | 1-175 | 218 | 98 | 175 | ref|YP_328664.1| | translation initiation factor IF-3 [Chlamydia trachomatis A/... |
| 1262673 | Chlamydia trachomatis L2/434/Bu(f) | 1 (0.04%) | 2E-57 | 1-175 | 24-198 | 227 | 97 | 175 | gb|AGJ64302.2| | translation initiation factor IF-3 [Chlamydia trachomatis L2... |
| 264202 | Chlamydophila felis Fe/C-56 | 1 (0.04%) | 1E-54 | 1-175 | 1-175 | 218 | 86 | 175 | ref|YP_515160.1| | translation initiation factor IF-3 [Chlamydophila felis Fe/C... |
| 138677 | Chlamydophila pneumoniae J138 | 1 (0.04%) | 5E-54 | 1-175 | 1-175 | 216 | 86 | 175 | ref|NP_225184.1| | translation initiation factor IF-3 [Chlamydophila pneumoniae... |
| 406984 | Chlamydophila pneumoniae LPCoLN | 1 (0.04%) | 3E-54 | 1-175 | 1-175 | 216 | 86 | 175 | ref|YP_005662427.1| | translation initiation factor IF-3 [Chlamydophila pneumoniae... |
| 1112249 | Chlamydia psittaci C6/98 | 1 (0.04%) | 4E-54 | 1-175 | 1-175 | 216 | 86 | 175 | ref|YP_004422597.1| | translation initiation factor IF-3 [Chlamydia psittaci 6BC] ... |
| 227941 | Chlamydophila caviae GPIC | 1 (0.04%) | 8E-54 | 1-175 | 1-175 | 215 | 86 | 175 | ref|NP_829634.1| | translation initiation factor IF-3 [Chlamydophila caviae GPI... |
| 1234369 | Chlamydia pecorum P787 | 1 (0.04%) | 4E-53 | 1-175 | 1-175 | 213 | 79 | 175 | ref|YP_004376781.1| | translation initiation factor IF-3 [Chlamydophila pecorum E5... |
| 331113 | Simkania negevensis Z | 1 (0.04%) | 3E-53 | 5-171 | 1-167 | 213 | 62 | 167 | ref|YP_004671760.1| | translation initiation factor IF-3 [Simkania negevensis Z] r... |
| 765952 | Parachlamydia acanthamoebae UV-7 | 1 (0.04%) | 3E-50 | 5-173 | 1-169 | 203 | 59 | 169 | ref|YP_004652062.1| | translation initiation factor IF-3 [Parachlamydia acanthamoe... |
| 716544 | Waddlia chondrophila WSU 86-1044 | 1 (0.04%) | 8E-53 | 5-172 | 1-168 | 211 | 57 | 168 | ref|YP_003709281.1| | Translation initiation factor IF-3 [Waddlia chondrophila WSU... |
| 1392 | Bacillus anthracis | 1 (0.04%) | 1E-28 | 5-93 | 1-89 | 131 | 57 | 89 | ref|WP_009879824.1| | translation initiation factor IF-3 [Bacillus anthracis] |
| 626939 | Phascolarctobacterium succinatutens YIT 12067 | 1 (0.04%) | 1E-58 | 5-171 | 1-167 | 231 | 55 | 167 | ref|WP_009145116.1| | translation initiation factor IF-3 [Phascolarctobacterium su... |
| 198431 | uncultured prokaryote | 1 (0.04%) | 1E-22 | 42-123 | 1-82 | 111 | 55 | 82 | gb|ADC34596.1| | translation initation factor IF-3-like protein [uncultured p... |