old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170
	MALNLRINRQIRAPRVRVIGSAGEQLGILSIKEALDLAKEANLDLVEVASNSEPPVCKIMDYGKYRYDVTKKEKDSKKAQHQVRIKEVKLKPNIDDNDFLTKAKQARAFIEKGNKVKVSCMFRGRELAYPEHGYKVIQRMCQGLEDIGFVESEPKLNGRSLICVIAPGTLKTKKK
tmhmm (0)	-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)	-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (18%)	XXX--------------------------------------------------------------XXXXXXXXXXXXXXXXXX---------------------------------------------------------------------------------XXXXXXXXXXX
psipred	--------------EEEEE--------EEEHHHHHHHHHHH---EEEE-------EEEEE-HHHHHHHHHHHHHHHHH--------EEEE-------HHHHHHHHHHHHHH---EEEEEEEE-------HHHHHHHHHHHHHHH---EEEEE-------EEEEEEEE--------

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    35	    0.124
  max. Y    15	    0.187
  max. S     9	    0.457
  mean S     1-14   0.344
       D     1-14   0.248    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.248 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-175	alignment	5lmnX_201	1-168	0.5238	--

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
1071765	Chlamydia trachomatis G/SotonG1	1 (0.04%)	2E-56	1-175	1-175	223	100	175	ref|NP_220354.1|	Initiation Factor 3 [Chlamydia trachomatis D/UW-3/CX] ref|YP...
813	Chlamydia trachomatis	3 (0.11%)	7E-60	1-175	84-258	235	99	175	ref|YP_005808226.1|	translation initiation factor IF-3 [Chlamydia trachomatis G/...
1100833	Chlamydia trachomatis F/SWFPminus	1 (0.04%)	5E-56	1-175	1-175	222	99	175	ref|YP_005816470.1|	protein translation initiation factor 3 (IF-3) [Chlamydia tr...
1071767	Chlamydia trachomatis Ia/SotonIa3	1 (0.04%)	2E-55	1-175	1-175	220	99	175	ref|YP_007736155.1|	translation initiation factor IF-3 [Chlamydia trachomatis Ia...
580047	Chlamydia trachomatis A2497	1 (0.04%)	9E-57	1-175	24-198	224	98	175	ref|YP_005813737.1|	Bacterial Protein Translation Initiation Factor 3 (IF-3) [Ch...
1007870	Chlamydia trachomatis RC-L2/55	1 (0.04%)	6E-55	1-175	1-175	219	98	175	ref|YP_001654295.1|	translation initiation factor IF-3 [Chlamydia trachomatis 43...
1071753	Chlamydia trachomatis A/363	1 (0.04%)	1E-54	1-175	1-175	218	98	175	ref|YP_328664.1|	translation initiation factor IF-3 [Chlamydia trachomatis A/...
1262673	Chlamydia trachomatis L2/434/Bu(f)	1 (0.04%)	2E-57	1-175	24-198	227	97	175	gb|AGJ64302.2|	translation initiation factor IF-3 [Chlamydia trachomatis L2...
264202	Chlamydophila felis Fe/C-56	1 (0.04%)	1E-54	1-175	1-175	218	86	175	ref|YP_515160.1|	translation initiation factor IF-3 [Chlamydophila felis Fe/C...
138677	Chlamydophila pneumoniae J138	1 (0.04%)	5E-54	1-175	1-175	216	86	175	ref|NP_225184.1|	translation initiation factor IF-3 [Chlamydophila pneumoniae...
406984	Chlamydophila pneumoniae LPCoLN	1 (0.04%)	3E-54	1-175	1-175	216	86	175	ref|YP_005662427.1|	translation initiation factor IF-3 [Chlamydophila pneumoniae...
1112249	Chlamydia psittaci C6/98	1 (0.04%)	4E-54	1-175	1-175	216	86	175	ref|YP_004422597.1|	translation initiation factor IF-3 [Chlamydia psittaci 6BC] ...
227941	Chlamydophila caviae GPIC	1 (0.04%)	8E-54	1-175	1-175	215	86	175	ref|NP_829634.1|	translation initiation factor IF-3 [Chlamydophila caviae GPI...
1234369	Chlamydia pecorum P787	1 (0.04%)	4E-53	1-175	1-175	213	79	175	ref|YP_004376781.1|	translation initiation factor IF-3 [Chlamydophila pecorum E5...
331113	Simkania negevensis Z	1 (0.04%)	3E-53	5-171	1-167	213	62	167	ref|YP_004671760.1|	translation initiation factor IF-3 [Simkania negevensis Z] r...
765952	Parachlamydia acanthamoebae UV-7	1 (0.04%)	3E-50	5-173	1-169	203	59	169	ref|YP_004652062.1|	translation initiation factor IF-3 [Parachlamydia acanthamoe...
716544	Waddlia chondrophila WSU 86-1044	1 (0.04%)	8E-53	5-172	1-168	211	57	168	ref|YP_003709281.1|	Translation initiation factor IF-3 [Waddlia chondrophila WSU...
1392	Bacillus anthracis	1 (0.04%)	1E-28	5-93	1-89	131	57	89	ref|WP_009879824.1|	translation initiation factor IF-3 [Bacillus anthracis]
626939	Phascolarctobacterium succinatutens YIT 12067	1 (0.04%)	1E-58	5-171	1-167	231	55	167	ref|WP_009145116.1|	translation initiation factor IF-3 [Phascolarctobacterium su...
198431	uncultured prokaryote	1 (0.04%)	1E-22	42-123	1-82	111	55	82	gb|ADC34596.1|	translation initation factor IF-3-like protein [uncultured p...