old.robetta.org

A new Robetta server is available for structure prediction.

     
Fragment Libraries    Alanine Scanning    DNA Interface Scan
[ Queue ] [ Submit ]    [ Queue ] [ Submit ]    [ Queue ] [ Submit ]
[ Register / Update ] [ Docs / FAQs ] [ Login ]


     
Job 82024 [SSGCID - ChtrB.01013.a] [2018-03-09] [D-172-16-30-137.dhcp4.x.x] [Structure] [Complete] 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (BPG-dependent PGAM) (PGAM) (Phosphoglyceromutase) (dPGM) (EC 5.4.2.11) - BATCH:82003

Full Structure Predictions  
Model 1

 chemical/x-pdb  MIME type  PDB file
Model 2

 chemical/x-pdb  MIME type  PDB file
Model 3

 chemical/x-pdb  MIME type  PDB file
Model 4

 chemical/x-pdb  MIME type  PDB file
Model 5

 chemical/x-pdb  MIME type  PDB file

Click the icons below each image to download the prediction in PDB format ( PDB file )

Images were produced using MolScript and Raster3D!




Plots powered by Plotly.js.

Features and Secondary Structure  
 
1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220   
 
MTLLILLRHGQSVWNQKNLFTGWVDIPLSQQGIQEAIAAGESIKHLPIDCIFTSTLVRSLITALLAMTNHSSQKVPYIVHEERPDMSRIHSQKEMEQMIPLFQSSALNERMYGELQGKNKQEVAAQFGEEQVKLWRRSYRIAPPQGESLFDTGQRTLPYFQERIFPLLQQGKNIFISAHGNSLRSLIMDLEKLSEEQVLSLELPTGQPIVYEWTGQKFTKHAPSLG
tmhmm (0)
----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)
----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)
----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (2%)
---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXX--X
psipred
--EEEEEE----HHHH--EEE----HHHHHHHHHHHHHHHHHHH-----EEE----HHHHHHHHHHHHH-----------HHHHHHHHHHHHHHHH-----EEHHHH------------HHHHHHH--HHHHH---------------HHHHHHHHHHHHHHHHHHHH----EEEEE--HHHHHHHHHHHH---HHHHH-------EEEEEEEE--EEEE------

# SignalP-4.0 euk predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    16	    0.185
  max. Y    16	    0.220
  max. S    12	    0.442
  mean S     1-15   0.285
       D     1-15   0.255    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.255 D-cutoff=0.450 Networks=SignalP-noTM


Domain Repeats Prediction     Top
  Boundary     STD (+/-)     Consensus  
------


Ginzu Domain Prediction 1       Top
Domain Span Source Reference Parent   Parent Span     Confidence     Annotations  
  1-226     alignment     4qihB_301     1-201   0.7644   --


PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA       Top
TaxID Species Alignments PSI-Blast Data (alignment with lowest E value)
E value Query Span Sbjct Span Bit Score Identity HSP Length Accession Description
813Chlamydia trachomatis2 (0.05%)1E-661-2264-229259100226ref|YP_005811776.1|phosphoglycerate mutase [Chlamydia trachomatis D-EC] ref|YP_...
1071782Chlamydia trachomatis L2b/Ams51 (0.03%)1E-661-2261-226259100226ref|YP_001653194.1|phosphoglyceromutase [Chlamydia trachomatis L2b/UCH-1/procti...
1071768Chlamydia trachomatis K/SotonK11 (0.03%)1E-661-2261-226258100226ref|YP_007731570.1|phosphoglyceromutase [Chlamydia trachomatis K/SotonK1] ref|W...
907272Chlamydia trachomatis J/6276tet11 (0.03%)1E-661-2261-226258100226ref|NP_220241.1|Phosphoglycerate Mutase [Chlamydia trachomatis D/UW-3/CX] re...
1071771Chlamydia trachomatis L1/2241 (0.03%)7E-671-2261-22625999226ref|YP_007722491.1|phosphoglyceromutase [Chlamydia trachomatis L1/440/LN] ref|Y...
1100833Chlamydia trachomatis F/SWFPminus1 (0.03%)1E-661-2261-22625899226ref|YP_005809954.1|phosphoglyceromutase [Chlamydia trachomatis E/11023] ref|YP_...
1262673Chlamydia trachomatis L2/434/Bu(f)1 (0.03%)2E-661-2264-22925899226gb|AGJ64178.2|phosphoglycerate mutase [Chlamydia trachomatis L2/434/Bu(i)]...
1007870Chlamydia trachomatis RC-L2/551 (0.03%)3E-661-2261-22625799226ref|YP_001654182.1|phosphoglyceromutase [Chlamydia trachomatis 434/Bu] ref|YP_0...
243161Chlamydia muridarum str. Nigg1 (0.03%)6E-661-2261-22625690226ref|NP_296479.1|phosphoglycerate mutase [Chlamydia muridarum str. Nigg] ref|...
83560Chlamydia muridarum1 (0.03%)6E-641-2261-22624990226ref|WP_010232684.1|phosphoglycerate mutase [Chlamydia muridarum]
182082Chlamydophila pneumoniae TW-1831 (0.03%)1E-591-2261-22823675228ref|NP_225058.1|phosphoglyceromutase [Chlamydophila pneumoniae CWL029] ref|N...
406984Chlamydophila pneumoniae LPCoLN1 (0.03%)2E-591-2261-22823475228ref|YP_005662572.1|2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [C...
138677Chlamydophila pneumoniae J1381 (0.03%)2E-591-2261-22823475228ref|NP_300920.1|phosphoglyceromutase [Chlamydophila pneumoniae J138] ref|WP_...
227941Chlamydophila caviae GPIC1 (0.03%)2E-571-2261-22722874227ref|NP_829765.1|phosphoglyceromutase [Chlamydophila caviae GPIC] ref|WP_0110...
264202Chlamydophila felis Fe/C-561 (0.03%)2E-571-2261-22722874227ref|YP_515027.1|phosphoglyceromutase [Chlamydophila felis Fe/C-56] ref|WP_01...
1234369Chlamydia pecorum P7871 (0.03%)1E-611-2261-22824273228ref|YP_004376900.1|2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [C...
1050221Chlamydia psittaci NJ11 (0.03%)3E-591-22645-27123473227ref|YP_006741032.1|phosphoglycerate mutase [Chlamydia psittaci NJ1] ref|WP_0149...
1112249Chlamydia psittaci C6/981 (0.03%)2E-571-2261-22722773227ref|YP_004422721.1|phosphoglycerate mutase [Chlamydia psittaci 6BC] ref|YP_0056...
1112270Chlamydia psittaci 09DC791 (0.03%)5E-571-2261-22722673227ref|YP_006739977.1|phosphoglycerate mutase [Chlamydia psittaci CP3] ref|YP_0067...
1003238Chlamydophila abortus LLG1 (0.03%)9E-571-2261-22722673227ref|YP_220259.1|phosphoglyceromutase [Chlamydophila abortus S26/3] ref|WP_00...






Robetta is available for NON-COMMERCIAL USE ONLY at this time
[ Terms of Service ]
Copyright © 2004-2011 University of Washington