| Features and Secondary Structure |
| | 1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280 . 290 . 300 . 310 . 320 . 330 . 340 . 350 . 360 . 370 . 380 . 390 . 400 . 410 |
| | MNFLQKPRGVKDWFGDELVYFNWIVKKIRSLAFNWGFSEVKTPLFENAQLFQRSNANADIVQKELYQFFDKSQRELALRPEATTPIVRLACENKLMQEANFPLKLFCIGSMYRYERPQNNRFREHWQFSCEVFGFSNLFIFLDTLLFANSLLEALGITGYVLKINNLANFETLSKWNKALKDYLTPYKLELTELSQKRLEKNPLRILDDKIDQKKSFVKNAPKITDFLDASAKQDSELLKTQLKKHNISFEWTDNLVRGLDYYTGFVFEYVKNQDTILAGGVYDNLVEELSSNPTPALGFACGIERLINCLEIDKKAFILNTKPKQMLVICLFEEALEELVWLAKLWREYNQVTIYPKVIKVDNGIRLANRLGYTFIGIVGKTDFDKKAITIKNLVSKQQTIYTWNELGERNVF |
| tmhmm (0) | ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ |
| low complexity (0%) | ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ |
| coiled-coils (0%) | ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ |
| disordered (1%) | XXX--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| psipred | --------------HHHHHHHHHHHHHHHHHHHH---EEEE---EEHHHHH----------HHHEEE-------------HHHHHHHHHHHH----------EEEEEE--EEE-----------------EEE--------HHHHHHHHHHHHH-----EEEEE----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----------HHH--------HHEEEE-----------HHHHHHH---------EEEEE----HHHHHHH------------EEEEE---HHHHHHHHHHHHHHH--EEEEE-----HHHHHHHHHH----EEEEE--HHHH--EEEEEE-----EEEEEHHHHHHHH-- |
PSI-BLAST Sequence Hits (Top 20 by Identity) ALL DATA
|
| TaxID |
Species |
Alignments |
PSI-Blast Data (alignment with lowest E value) |
| E value |
Query Span |
Sbjct Span |
Bit Score |
Identity |
HSP Length |
Accession |
Description |
| 432331 | Sulfurihydrogenibium yellowstonense SS-5 | 1 (0.03%) | 1E-82 | 1-290 | 1-293 | 314 | 40 | 295 | ref|WP_007547735.1| | histidyl-tRNA synthetase [Sulfurihydrogenibium yellowstonens... |
| 269666 | Streptococcus marimammalium | 1 (0.03%) | 1E-136 | 2-410 | 1-415 | 491 | 38 | 416 | ref|WP_018370481.1| | histidyl-tRNA synthase [Streptococcus marimammalium] |
| 598659 | Nautilia profundicola AmH | 1 (0.03%) | 1E-108 | 3-395 | 1-386 | 399 | 38 | 398 | ref|YP_002606788.1| | histidyl-tRNA synthetase [Nautilia profundicola AmH] ref|WP_... |
| 626096 | Ureaplasma urealyticum serovar 2 str. ATCC 27814 | 1 (0.03%) | 1E-94 | 1-408 | 1-416 | 353 | 38 | 417 | ref|YP_002284686.1| | histidyl-tRNA synthetase [Ureaplasma urealyticum serovar 10 ... |
| 1247 | Oenococcus oeni | 1 (0.03%) | 9E-88 | 5-285 | 7-296 | 330 | 38 | 290 | gb|ABA02297.1| | HisRS [Oenococcus oeni] |
| 64642 | Tetragenococcus muriaticus | 1 (0.03%) | 9E-88 | 5-285 | 7-296 | 330 | 38 | 290 | gb|ABA02301.1| | HisRS [Lactobacillus sakei] gb|ABA02305.1| HisRS [Tetragenoc... |
| 708616 | Mycoplasma gallisepticum str. F | 1 (0.03%) | 4E-86 | 2-409 | 4-418 | 325 | 38 | 416 | ref|YP_005880476.1| | histidyl-tRNA synthetase [Mycoplasma gallisepticum str. F] r... |
| 710128 | Mycoplasma gallisepticum str. R(high) | 1 (0.03%) | 6E-86 | 2-409 | 4-418 | 324 | 38 | 416 | ref|NP_852966.2| | histidyl-tRNA synthetase [Mycoplasma gallisepticum str. R(lo... |
| 81408 | Geobacillus caldoxylosilyticus | 1 (0.03%) | 1E-140 | 2-410 | 1-416 | 504 | 37 | 417 | ref|WP_017435559.1| | histidyl-tRNA synthetase [Geobacillus caldoxylosilyticus] |
| 1158606 | Enterococcus asini ATCC 700915 | 1 (0.03%) | 1E-131 | 2-411 | 1-418 | 473 | 37 | 419 | ref|WP_010752863.1| | histidyl-tRNA synthetase [Enterococcus asini] gb|EOH90462.1|... |
| 746361 | Lactococcus lactis subsp. cremoris NZ9000 | 3 (0.08%) | 1E-126 | 2-410 | 1-415 | 457 | 37 | 416 | ref|YP_001033467.1| | histidyl-tRNA synthetase [Lactococcus lactis subsp. cremoris... |
| 525329 | Lactobacillus jensenii JV-V16 | 2 (0.05%) | 1E-124 | 2-407 | 1-415 | 453 | 37 | 416 | ref|WP_006586807.1| | histidyl-tRNA synthase [Lactobacillus jensenii] gb|EEU21454.... |
| 381764 | Fervidobacterium nodosum Rt17-B1 | 2 (0.05%) | 1E-116 | 3-406 | 1-407 | 424 | 37 | 411 | ref|YP_001410953.1| | histidyl-tRNA synthetase [Fervidobacterium nodosum Rt17-B1] ... |
| 1276647 | Streptococcus suis TL13 | 1 (0.03%) | 1E-134 | 2-408 | 1-413 | 484 | 36 | 414 | ref|YP_007974681.1| | Histidyl-tRNA synthetase [Streptococcus suis TL13] ref|WP_01... |
| 1007064 | Streptococcus suis ST3 | 1 (0.03%) | 1E-133 | 2-408 | 1-413 | 482 | 36 | 414 | ref|YP_004400940.1| | histidyl-tRNA synthetase [Streptococcus suis ST3] ref|YP_008... |
| 1004952 | Streptococcus suis D12 | 1 (0.03%) | 1E-133 | 2-408 | 1-413 | 481 | 36 | 414 | ref|YP_006081842.1| | histidyl-tRNA synthetase [Streptococcus suis D12] ref|WP_014... |
| 873448 | Streptococcus porcinus str. Jelinkova 176 | 1 (0.03%) | 1E-132 | 2-408 | 1-413 | 480 | 36 | 414 | ref|WP_003083359.1| | histidyl-tRNA synthase [Streptococcus porcinus] gb|EGJ26828.... |
| 1005042 | Streptococcus suis D9 | 1 (0.03%) | 1E-132 | 2-408 | 1-413 | 479 | 36 | 414 | ref|YP_006079807.1| | histidyl-tRNA synthetase [Streptococcus suis D9] ref|WP_0029... |
| 996306 | Streptococcus suis R61 | 1 (0.03%) | 1E-132 | 2-408 | 1-413 | 479 | 36 | 414 | ref|WP_002941204.1| | histidyl-tRNA synthase [Streptococcus suis] gb|EHC03160.1| h... |
| 1246365 | Streptococcus suis SC070731 | 2 (0.05%) | 1E-132 | 2-408 | 1-413 | 479 | 36 | 414 | ref|YP_006075641.1| | histidyl-tRNA synthetase [Streptococcus suis JS14] ref|YP_00... |