old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280 . 290 . 300 . 310 . 320 . 330 . 340 . 350 . 360 . 370 . 380 . 390 . 400 . 410
	MNFLQKPRGVKDWFGDELVYFNWIVKKIRSLAFNWGFSEVKTPLFENAQLFQRSNANADIVQKELYQFFDKSQRELALRPEATTPIVRLACENKLMQEANFPLKLFCIGSMYRYERPQNNRFREHWQFSCEVFGFSNLFIFLDTLLFANSLLEALGITGYVLKINNLANFETLSKWNKALKDYLTPYKLELTELSQKRLEKNPLRILDDKIDQKKSFVKNAPKITDFLDASAKQDSELLKTQLKKHNISFEWTDNLVRGLDYYTGFVFEYVKNQDTILAGGVYDNLVEELSSNPTPALGFACGIERLINCLEIDKKAFILNTKPKQMLVICLFEEALEELVWLAKLWREYNQVTIYPKVIKVDNGIRLANRLGYTFIGIVGKTDFDKKAITIKNLVSKQQTIYTWNELGERNVF
tmhmm (0)	------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)	------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (1%)	XXX---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
psipred	--------------HHHHHHHHHHHHHHHHHHHH---EEEE---EEHHHHH----------HHHEEE-------------HHHHHHHHHHHH----------EEEEEE--EEE-----------------EEE--------HHHHHHHHHHHHH-----EEEEE----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----------HHH--------HHEEEE-----------HHHHHHH---------EEEEE----HHHHHHH------------EEEEE---HHHHHHHHHHHHHHH--EEEEE-----HHHHHHHHHH----EEEEE--HHHH--EEEEEE-----EEEEEHHHHHHHH--

# SignalP-4.0 gram- predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    59	    0.205
  max. Y    59	    0.140
  max. S    40	    0.154
  mean S     1-58   0.104
       D     1-58   0.123    0.570  NO
Name=tmp_signalp_seq	SP='NO' D=0.123 D-cutoff=0.570 Networks=SignalP-noTM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-414	alignment	4e51A_202	1-416	0.9726	LIGASE

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
432331	Sulfurihydrogenibium yellowstonense SS-5	1 (0.03%)	1E-82	1-290	1-293	314	40	295	ref|WP_007547735.1|	histidyl-tRNA synthetase [Sulfurihydrogenibium yellowstonens...
269666	Streptococcus marimammalium	1 (0.03%)	1E-136	2-410	1-415	491	38	416	ref|WP_018370481.1|	histidyl-tRNA synthase [Streptococcus marimammalium]
598659	Nautilia profundicola AmH	1 (0.03%)	1E-108	3-395	1-386	399	38	398	ref|YP_002606788.1|	histidyl-tRNA synthetase [Nautilia profundicola AmH] ref|WP_...
626096	Ureaplasma urealyticum serovar 2 str. ATCC 27814	1 (0.03%)	1E-94	1-408	1-416	353	38	417	ref|YP_002284686.1|	histidyl-tRNA synthetase [Ureaplasma urealyticum serovar 10 ...
1247	Oenococcus oeni	1 (0.03%)	9E-88	5-285	7-296	330	38	290	gb|ABA02297.1|	HisRS [Oenococcus oeni]
64642	Tetragenococcus muriaticus	1 (0.03%)	9E-88	5-285	7-296	330	38	290	gb|ABA02301.1|	HisRS [Lactobacillus sakei] gb|ABA02305.1| HisRS [Tetragenoc...
708616	Mycoplasma gallisepticum str. F	1 (0.03%)	4E-86	2-409	4-418	325	38	416	ref|YP_005880476.1|	histidyl-tRNA synthetase [Mycoplasma gallisepticum str. F] r...
710128	Mycoplasma gallisepticum str. R(high)	1 (0.03%)	6E-86	2-409	4-418	324	38	416	ref|NP_852966.2|	histidyl-tRNA synthetase [Mycoplasma gallisepticum str. R(lo...
81408	Geobacillus caldoxylosilyticus	1 (0.03%)	1E-140	2-410	1-416	504	37	417	ref|WP_017435559.1|	histidyl-tRNA synthetase [Geobacillus caldoxylosilyticus]
1158606	Enterococcus asini ATCC 700915	1 (0.03%)	1E-131	2-411	1-418	473	37	419	ref|WP_010752863.1|	histidyl-tRNA synthetase [Enterococcus asini] gb|EOH90462.1|...
746361	Lactococcus lactis subsp. cremoris NZ9000	3 (0.08%)	1E-126	2-410	1-415	457	37	416	ref|YP_001033467.1|	histidyl-tRNA synthetase [Lactococcus lactis subsp. cremoris...
525329	Lactobacillus jensenii JV-V16	2 (0.05%)	1E-124	2-407	1-415	453	37	416	ref|WP_006586807.1|	histidyl-tRNA synthase [Lactobacillus jensenii] gb|EEU21454....
381764	Fervidobacterium nodosum Rt17-B1	2 (0.05%)	1E-116	3-406	1-407	424	37	411	ref|YP_001410953.1|	histidyl-tRNA synthetase [Fervidobacterium nodosum Rt17-B1] ...
1276647	Streptococcus suis TL13	1 (0.03%)	1E-134	2-408	1-413	484	36	414	ref|YP_007974681.1|	Histidyl-tRNA synthetase [Streptococcus suis TL13] ref|WP_01...
1007064	Streptococcus suis ST3	1 (0.03%)	1E-133	2-408	1-413	482	36	414	ref|YP_004400940.1|	histidyl-tRNA synthetase [Streptococcus suis ST3] ref|YP_008...
1004952	Streptococcus suis D12	1 (0.03%)	1E-133	2-408	1-413	481	36	414	ref|YP_006081842.1|	histidyl-tRNA synthetase [Streptococcus suis D12] ref|WP_014...
873448	Streptococcus porcinus str. Jelinkova 176	1 (0.03%)	1E-132	2-408	1-413	480	36	414	ref|WP_003083359.1|	histidyl-tRNA synthase [Streptococcus porcinus] gb|EGJ26828....
1005042	Streptococcus suis D9	1 (0.03%)	1E-132	2-408	1-413	479	36	414	ref|YP_006079807.1|	histidyl-tRNA synthetase [Streptococcus suis D9] ref|WP_0029...
996306	Streptococcus suis R61	1 (0.03%)	1E-132	2-408	1-413	479	36	414	ref|WP_002941204.1|	histidyl-tRNA synthase [Streptococcus suis] gb|EHC03160.1| h...
1246365	Streptococcus suis SC070731	2 (0.05%)	1E-132	2-408	1-413	479	36	414	ref|YP_006075641.1|	histidyl-tRNA synthetase [Streptococcus suis JS14] ref|YP_00...