old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240
	MRTRYLIGNWKTNKNLKDAVSFVEQFQQNKLNYNAKIGIAPVYVHLTEIKKIISDSLLLFAQDANFIESGSYTGTVSFTQLQDIGVNNSIIGHSERRKYYNETSAVINQKLFACLKASMQVVLCIGEALGQEISFLKTDLTNCLDTIDKSLIKNLVIAYEPLWAIGTGKTATPEVANQTIKTIREYINDLYDENVANNISILYGGSVDHNNIQKLAIMEQIDGFLVGKASLEIKNFLEMARVYA
tmhmm (0)	----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)	----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (0%)	----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
psipred	----EEEEE------HHHHHHHHHHHH--------EEEEE-----HHHHHHHHHHHEEEEE----------HHHHHHHHHHHH----EEEE-------------HHHHHHHHHHHH---EEEEE----HHHHHHHHHHHHHHHHH-------HHHHHHH--HHHHH------HHHHHHHHHHHHHHHHHH--------EEEEEE----HHHHHHHH------EEEE------HHHHHHHHHHH-

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    36	    0.110
  max. Y     2	    0.162
  max. S     1	    0.266
  mean S     1-1    0.266
       D     1-1    0.203    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.203 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-244	alignment	4bi7A_201	1-256	0.9665	--

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
40477	Mycoplasma mycoides subsp. capri	1 (0.03%)	4E-53	70-223	1-159	214	45	159	gb|ACA23513.1|	triosephospate isomerase [Mycoplasma mycoides subsp. capri]
2105	Mycoplasma leachii	1 (0.03%)	2E-53	70-223	1-159	214	44	159	gb|ACA23514.1|	triosephospate isomerase [Mycoplasma leachii]
44101	Mycoplasma mycoides subsp. mycoides SC	1 (0.03%)	4E-53	70-223	1-159	214	43	159	gb|ACA23512.1|	triosephospate isomerase [Mycoplasma mycoides subsp. mycoide...
2102	Mycoplasma mycoides	2 (0.06%)	3E-52	70-223	1-159	211	43	159	gb|ACA23508.1|	triosephospate isomerase [Mycoplasma mycoides]
2095	Mycoplasma capricolum	2 (0.06%)	3E-52	70-223	1-159	211	43	159	gb|ACA23509.1|	triosephospate isomerase [Mycoplasma capricolum] gb|ACA23511...
639282	Deferribacter desulfuricans SSM1	1 (0.03%)	2E-87	1-243	1-249	328	41	249	ref|YP_003495397.1|	triose-phosphate isomerase [Deferribacter desulfuricans SSM1...
907348	Treponema saccharophilum DSM 2985	1 (0.03%)	2E-84	1-242	1-248	318	41	248	ref|WP_002703996.1|	triosephosphate isomerase [Treponema saccharophilum] gb|EIC0...
1129368	Spiroplasma melliferum IPMB4A	1 (0.03%)	5E-84	1-241	1-245	317	41	246	ref|WP_004028304.1|	triosephosphate isomerase [Spiroplasma melliferum] gb|EHK517...
2133	Spiroplasma citri	1 (0.03%)	3E-83	1-241	1-245	314	41	246	emb|CAK98494.1|	triosephosphate isomerase protein [Spiroplasma citri]
391606	Carboxydibrachium pacificum DSM 12653	1 (0.03%)	8E-69	64-241	1-183	266	41	183	ref|WP_009611308.1|	triosephosphate isomerase [Caldanaerobacter subterraneus] gb...
52970	Rhodomonas salina	1 (0.03%)	1E-54	70-234	1-167	219	41	167	gb|ABD51962.1|	chloroplast triose phosphate isomerase [Rhodomonas salina]
580327	Thermoanaerobacterium thermosaccharolyticum DSM 571	1 (0.03%)	4E-96	1-241	1-247	357	40	247	ref|YP_003852585.1|	triosephosphate isomerase [Thermoanaerobacterium thermosacch...
498214	Clostridium botulinum A3 str. Loch Maree	1 (0.03%)	4E-96	1-242	1-248	357	40	248	ref|YP_001785559.1|	triosephosphate isomerase [Clostridium botulinum A3 str. Loc...
698948	Thermoanaerobacterium thermosaccharolyticum M0795	1 (0.03%)	5E-96	1-241	1-247	356	40	247	ref|YP_007299331.1|	triosephosphate isomerase [Thermoanaerobacterium thermosacch...
858215	Thermoanaerobacterium xylanolyticum LX-11	1 (0.03%)	5E-95	1-241	1-247	353	40	247	ref|YP_004470529.1|	triosephosphate isomerase [Thermoanaerobacterium xylanolytic...
1232188	Clostridium botulinum CFSAN001628	1 (0.03%)	1E-94	1-241	1-247	352	40	247	ref|YP_001779859.1|	triosephosphate isomerase [Clostridium botulinum B1 str. Okr...
758678	Clostridium botulinum F str. 230613	1 (0.03%)	7E-95	1-241	1-247	352	40	247	ref|YP_001389591.1|	triosephosphate isomerase [Clostridium botulinum F str. Lang...
941968	Clostridium botulinum H04402 065	1 (0.03%)	2E-94	1-241	1-247	351	40	247	ref|YP_005676799.1|	triosephosphate isomerase [Clostridium botulinum H04402 065]...
340099	Thermoanaerobacter pseudethanolicus ATCC 33223	1 (0.03%)	6E-93	1-241	1-247	346	40	247	ref|YP_001664729.1|	triosephosphate isomerase [Thermoanaerobacter pseudethanolic...
1198630	Thermoanaerobacter thermohydrosulfuricus WC1	1 (0.03%)	5E-92	2-241	10-255	343	40	246	ref|WP_004402122.1|	triosephosphate isomerase [Thermoanaerobacter] gb|EMT38496.1...