old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280 . 290 . 300 . 310 . 320 .
	MAFRFAVDCLGFENKPSEAIEAVLKYWSFHQDLNFILIGDEKAFDGLDILPKNITKKLANSFIEMTDTPLSARRKVNSSMQIAINLVREGNADVVISAGSSAVYASLTNDAFGKINKNTKSAFMSYVPTDNNNWFYFLDVGANKYFTGKELYFLGLMADIFVKKTTTKKTPKIGLLNIGTEENKGFDYHQEAFKLLKADKNLNFLGFVESRFLLDGICDILIADGYSGNLVLKAMEGTFKTIARILKRGYKRNPLAGLFSLGIIKSVAKKFDYKNNAGAVVMGLNKLALKTHGSADKQQFLSTIRLAHLSLKSDLINAIKTSLNNYEE
tmhmm (0)	----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (2%)	------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXX--------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (5%)	X-------------------------------------------------------------------XXXXXX--X--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXX
psipred	---EEEEEE------HHHHHHHHHHHHHH----EEEEEE-HHHHHHHHH-----EEE----EE-----HHHHHH-----HHHHHHHHH-----EEE----HHHHHHHHHHHH----------EEEE--------EEEE---------HHHHHHHHHHHHHHHHHH------EEEEEE--------HHHHHHHHHHHH------------HHHH------EEEE----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---------EEEE---EEEEE-----HHHHHHHHHHHHHHHHH-HHHHHHHHHHHH--

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    20	    0.192
  max. Y    20	    0.157
  max. S    18	    0.249
  mean S     1-19   0.123
       D     1-19   0.143    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.143 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-328	alignment	1vi1A_301	1-327	0.9319	Structural genomics, unknown function

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
662947	Mycoplasma genitalium M2288	1 (0.03%)	3E-86	1-328	1-328	325	100	328	ref|NP_073040.1|	glycerol-3-phosphate acyltransferase PlsX [Mycoplasma genita...
1112856	Mycoplasma pneumoniae 309	1 (0.03%)	3E-87	1-328	1-328	328	83	328	ref|YP_005175788.1|	putative glycerol-3-phosphate acyltransferase PlsX [Mycoplas...
518603	Ureaplasma urealyticum serovar 5 str. ATCC 27817	1 (0.03%)	5E-29	205-326	1-124	134	50	124	ref|WP_004026979.1|	fatty acid/phospholipid synthesis protein PlsX [Ureaplasma u...
626096	Ureaplasma urealyticum serovar 2 str. ATCC 27814	1 (0.03%)	1E-86	2-326	3-328	326	41	329	ref|YP_002284602.1|	putative glycerol-3-phosphate acyltransferase PlsX [Ureaplas...
649639	Bacillus cellulosilyticus DSM 2522	1 (0.03%)	1E-121	3-328	1-329	441	36	330	ref|YP_004095525.1|	fatty acid/phospholipid synthesis protein PlsX [Bacillus cel...
977905	Bacillus sp. 17376	1 (0.03%)	1E-123	3-325	1-326	449	35	327	ref|WP_023614929.1|	phosphate acyltransferase [Bacillus sp. 17376] gb|ESU33082.1...
904747	Staphylococcus aureus subsp. aureus 21266	1 (0.03%)	1E-123	3-328	189-515	449	35	330	ref|WP_000768422.1|	hypothetical protein [Staphylococcus aureus] gb|EGS86600.1| ...
1131935	Paenibacillus dendritiformis C454	1 (0.03%)	1E-122	3-323	1-325	443	35	326	ref|WP_006676621.1|	phosphate acyltransferase [Paenibacillus dendritiformis] gb|...
495036	Geobacillus sp. G11MC16	2 (0.06%)	1E-122	3-325	1-326	443	35	327	ref|YP_001125162.1|	glycerol-3-phosphate acyltransferase PlsX [Geobacillus therm...
948561	Staphylococcus aureus O11	1 (0.03%)	1E-120	3-328	2-328	436	35	330	ref|WP_000239739.1|	phosphate acyltransferase [Staphylococcus aureus] gb|EGA9871...
1137132	Staphylococcus aureus subsp. aureus 112808A	1 (0.03%)	1E-120	3-328	2-328	436	35	330	ref|NP_645929.1|	putative glycerol-3-phosphate acyltransferase PlsX [Staphylo...
585153	Staphylococcus aureus subsp. aureus E1410	1 (0.03%)	1E-119	3-328	2-328	436	35	330	ref|WP_000239747.1|	phosphate acyltransferase [Staphylococcus aureus] gb|EEV1156...
1194085	Staphylococcus aureus subsp. aureus SA40	1 (0.03%)	1E-119	3-328	2-328	436	35	330	ref|YP_416574.1|	glycerol-3-phosphate acyltransferase PlsX [Staphylococcus au...
585155	Staphylococcus aureus subsp. aureus H19	1 (0.03%)	1E-119	3-328	2-328	436	35	330	ref|WP_000239745.1|	phosphate acyltransferase [Staphylococcus aureus] gb|EFC0752...
1137131	Staphylococcus aureus subsp. aureus 122051	2 (0.06%)	1E-119	3-328	2-328	435	35	330	ref|YP_040616.1|	glycerol-3-phosphate acyltransferase PlsX [Staphylococcus au...
1193576	Staphylococcus aureus subsp. aureus CN1	1 (0.03%)	1E-119	3-328	9-335	435	35	330	ref|YP_008491344.1|	Fatty acid/phospholipid synthesis protein plsX [Staphylococc...
1203553	Staphylococcus aureus subsp. aureus KPL1845	1 (0.03%)	1E-119	3-328	2-328	435	35	330	ref|YP_186103.1|	glycerol-3-phosphate acyltransferase PlsX [Staphylococcus au...
754026	Staphylococcus aureus subsp. aureus MRSA177	1 (0.03%)	1E-119	3-328	9-335	435	35	330	ref|WP_001802631.1|	phosphate acyltransferase [Staphylococcus aureus] gb|EFM0613...
548473	Staphylococcus aureus subsp. aureus TCH60	1 (0.03%)	1E-119	3-328	9-335	435	35	330	ref|YP_005748085.1|	fatty acid/phospholipid synthesis protein PlsX [Staphylococc...
1157018	Staphylococcus aureus M0239	1 (0.03%)	1E-119	3-328	2-328	435	35	330	ref|WP_000239742.1|	phosphate acyltransferase [Staphylococcus aureus] gb|EGS8480...