old.robetta.org

A new Robetta server is available for structure prediction.

This service will be discontinued at the end of April 2026

     
Fragment Libraries    Alanine Scanning    DNA Interface Scan
[ Queue ] [ Submit ]    [ Queue ] [ Submit ]    [ Queue ] [ Submit ]
[ Register / Update ] [ Docs / FAQs ] [ Login ]


     
Job 85111 [SSGCID - MygeA.01086.a] [2018-08-03] [D-172-16-30-137.dhcp4.x.x] [Structure] [Complete] Cytidylate kinase (MG_330) - BATCH:85100

Full Structure Predictions  
Model 1

 chemical/x-pdb  MIME type  PDB file
Model 2

 chemical/x-pdb  MIME type  PDB file
Model 3

 chemical/x-pdb  MIME type  PDB file
Model 4

 chemical/x-pdb  MIME type  PDB file
Model 5

 chemical/x-pdb  MIME type  PDB file

Click the icons below each image to download the prediction in PDB format ( PDB file )

Images were produced using MolScript and Raster3D!




Plots powered by Plotly.js.

Features and Secondary Structure  
 
1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    
 
MNWQIAIDGPSSSGKSSVAKKIAEELDFFYFSSGKMYRAFAYVMQVNRLNIDLFLKIINQINWRFEKDAVYYNNADITTVITTQSVANIASKIAVDPNIRKIAVIKQQKLAENKNIVMDGRDIGTVVLKNAQLKFFLDAKVEIRAQRRLQDMGISLSNEKKLKELIQELKQRDQIDSSRTADPLKKAQDAIYLDTSELSFDAVVKQTLKEAKKVFKL
tmhmm (0)
-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (6%)
--------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXXXXXX----------------------------------------------
coiled-coils (0%)
-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (0%)
X------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
psipred
--EEEEEE------HHHHHHHHHHHH--EEE---HHHHHHHHHHHH----HHHHHHHHHH------------------HHH--HHHHHHHHHHH--HHHHHHHHHHHHHHHH---EEEEE-----EE-----EEEEEE--HHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHHHH---------EEEEE-----HHHHHHHHHHHHHHHH--

# SignalP-4.0 gram- predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    42	    0.203
  max. Y    42	    0.158
  max. S    38	    0.175
  mean S     1-41   0.086
       D     1-41   0.124    0.570  NO
Name=tmp_signalp_seq	SP='NO' D=0.124 D-cutoff=0.570 Networks=SignalP-noTM


Domain Repeats Prediction     Top
  Boundary     STD (+/-)     Consensus  
------


Ginzu Domain Prediction 1       Top
Domain Span Source Reference Parent   Parent Span     Confidence     Annotations  
  1-217     alignment     2femA_203     1-212   0.9343   SIGNALING PROTEIN,TRANSFERASE


PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA       Top
TaxID Species Alignments PSI-Blast Data (alignment with lowest E value)
E value Query Span Sbjct Span Bit Score Identity HSP Length Accession Description
2097Mycoplasma genitalium2 (0.07%)2E-4928-2173-192201100190ref|WP_009885981.1|cytidylate kinase [Mycoplasma genitalium]
1333Streptococcus criceti1 (0.04%)8E-121-421-43775343dbj|BAH11118.1|hypothetical protein, partial [Streptococcus criceti]
655813Streptococcus oralis ATCC 350371 (0.04%)1E-751-2151-22328845224ref|WP_000849411.1|cytidylate kinase [Streptococcus oralis] gb|EFE56130.1| cyti...
927666Streptococcus oralis Uo51 (0.04%)1E-751-2131-22128845222ref|YP_004325612.1|cytidylate kinase [Streptococcus oralis Uo5] ref|WP_00084941...
1169675Streptococcus sp. GMD6S1 (0.04%)1E-751-2131-22128845222ref|WP_000849412.1|cytidylate kinase [Streptococcus] gb|EKA06929.1| cytidylate ...
1169670Streptococcus sp. GMD1S1 (0.04%)1E-751-2131-22128845222ref|WP_000849414.1|cytidylate kinase [Streptococcus] gb|EKA16818.1| cytidylate ...
1095740Streptococcus oralis SK1001 (0.04%)1E-751-2131-22128845222ref|WP_000849413.1|cytidylate kinase [Streptococcus oralis] gb|EIC77688.1| cyti...
1161414Streptococcus sp. BS211 (0.04%)1E-751-2131-22128845222ref|WP_000849406.1|cytidylate kinase [Streptococcus] gb|EFX56384.1| cytidylate ...
768726Streptococcus mitis bv. 2 str. F03921 (0.04%)2E-751-2131-22128845222ref|WP_000849393.1|cytidylate kinase [Streptococcus mitis] gb|EGR93911.1| cytid...
1000588Streptococcus mitis bv. 2 str. SK951 (0.04%)2E-751-2151-22328845224ref|WP_000849392.1|cytidylate kinase [Streptococcus mitis] gb|EGU67704.1| cytid...
1303Streptococcus oralis1 (0.04%)2E-751-2131-22128745222ref|WP_000849415.1|cytidylate kinase [Streptococcus oralis] gb|EFU62279.1| cyti...
999424Streptococcus sp. F04411 (0.04%)2E-751-2131-22128745222ref|WP_009730415.1|cytidylate kinase [Streptococcus sp. F0441] gb|EKS16801.1| c...
861455Streptococcus sp. oral taxon 058 str. F04071 (0.04%)3E-751-2151-22328745224ref|WP_000849390.1|cytidylate kinase [Streptococcus sp. oral taxon 058] gb|EHI7...
1095741Streptococcus oralis SK6101 (0.04%)5E-751-2131-22128645222ref|WP_000849410.1|cytidylate kinase [Streptococcus] gb|EFA24225.1| cytidylate ...
864567Streptococcus mitis ATCC 62491 (0.04%)1E-741-2131-22128445222ref|WP_000849391.1|cytidylate kinase [Streptococcus mitis] gb|EFM30985.1| cytid...
864570Streptococcus sp. oral taxon 071 str. 73H25AP1 (0.04%)1E-751-2151-22328844224ref|WP_000849407.1|cytidylate kinase [Streptococcus sp. oral taxon 071] gb|EFM3...
936580Streptococcus sp. CM61 (0.04%)2E-751-2131-22128844222gb|EUC81304.1|cytidylate kinase [Streptococcus sp. CM6]
1333865Streptococcus tigurinus 24261 (0.04%)3E-751-2131-22128744222ref|WP_007521259.1|cytidylate kinase [Streptococcus tigurinus] gb|EMG34272.1| c...
1161421Streptococcus oralis SK3041 (0.04%)4E-751-2131-22128644222ref|WP_000849409.1|cytidylate kinase [Streptococcus oralis] gb|EGL90552.1| cyti...
1282664Streptococcus tigurinus AZ_3a1 (0.04%)6E-751-2131-22128644222ref|WP_007517025.1|cytidylate kinase [Streptococcus tigurinus] gb|EMG33332.1| c...






Robetta is available for NON-COMMERCIAL USE ONLY at this time
[ Terms of Service ]
Copyright © 2004-2011 University of Washington