old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210
	MNWQIAIDGPSSSGKSSVAKKIAEELDFFYFSSGKMYRAFAYVMQVNRLNIDLFLKIINQINWRFEKDAVYYNNADITTVITTQSVANIASKIAVDPNIRKIAVIKQQKLAENKNIVMDGRDIGTVVLKNAQLKFFLDAKVEIRAQRRLQDMGISLSNEKKLKELIQELKQRDQIDSSRTADPLKKAQDAIYLDTSELSFDAVVKQTLKEAKKVFKL
tmhmm (0)	-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (6%)	--------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXXXXXX----------------------------------------------
coiled-coils (0%)	-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (0%)	X------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
psipred	--EEEEEE------HHHHHHHHHHHH--EEE---HHHHHHHHHHHH----HHHHHHHHHH------------------HHH--HHHHHHHHHHH--HHHHHHHHHHHHHHHH---EEEEE-----EE-----EEEEEE--HHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHHHH---------EEEEE-----HHHHHHHHHHHHHHHH--

# SignalP-4.0 gram- predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    42	    0.203
  max. Y    42	    0.158
  max. S    38	    0.175
  mean S     1-41   0.086
       D     1-41   0.124    0.570  NO
Name=tmp_signalp_seq	SP='NO' D=0.124 D-cutoff=0.570 Networks=SignalP-noTM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-217	alignment	2femA_203	1-212	0.9343	SIGNALING PROTEIN,TRANSFERASE

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
2097	Mycoplasma genitalium	2 (0.07%)	2E-49	28-217	3-192	201	100	190	ref|WP_009885981.1|	cytidylate kinase [Mycoplasma genitalium]
1333	Streptococcus criceti	1 (0.04%)	8E-12	1-42	1-43	77	53	43	dbj|BAH11118.1|	hypothetical protein, partial [Streptococcus criceti]
655813	Streptococcus oralis ATCC 35037	1 (0.04%)	1E-75	1-215	1-223	288	45	224	ref|WP_000849411.1|	cytidylate kinase [Streptococcus oralis] gb|EFE56130.1| cyti...
927666	Streptococcus oralis Uo5	1 (0.04%)	1E-75	1-213	1-221	288	45	222	ref|YP_004325612.1|	cytidylate kinase [Streptococcus oralis Uo5] ref|WP_00084941...
1169675	Streptococcus sp. GMD6S	1 (0.04%)	1E-75	1-213	1-221	288	45	222	ref|WP_000849412.1|	cytidylate kinase [Streptococcus] gb|EKA06929.1| cytidylate ...
1169670	Streptococcus sp. GMD1S	1 (0.04%)	1E-75	1-213	1-221	288	45	222	ref|WP_000849414.1|	cytidylate kinase [Streptococcus] gb|EKA16818.1| cytidylate ...
1095740	Streptococcus oralis SK100	1 (0.04%)	1E-75	1-213	1-221	288	45	222	ref|WP_000849413.1|	cytidylate kinase [Streptococcus oralis] gb|EIC77688.1| cyti...
1161414	Streptococcus sp. BS21	1 (0.04%)	1E-75	1-213	1-221	288	45	222	ref|WP_000849406.1|	cytidylate kinase [Streptococcus] gb|EFX56384.1| cytidylate ...
768726	Streptococcus mitis bv. 2 str. F0392	1 (0.04%)	2E-75	1-213	1-221	288	45	222	ref|WP_000849393.1|	cytidylate kinase [Streptococcus mitis] gb|EGR93911.1| cytid...
1000588	Streptococcus mitis bv. 2 str. SK95	1 (0.04%)	2E-75	1-215	1-223	288	45	224	ref|WP_000849392.1|	cytidylate kinase [Streptococcus mitis] gb|EGU67704.1| cytid...
1303	Streptococcus oralis	1 (0.04%)	2E-75	1-213	1-221	287	45	222	ref|WP_000849415.1|	cytidylate kinase [Streptococcus oralis] gb|EFU62279.1| cyti...
999424	Streptococcus sp. F0441	1 (0.04%)	2E-75	1-213	1-221	287	45	222	ref|WP_009730415.1|	cytidylate kinase [Streptococcus sp. F0441] gb|EKS16801.1| c...
861455	Streptococcus sp. oral taxon 058 str. F0407	1 (0.04%)	3E-75	1-215	1-223	287	45	224	ref|WP_000849390.1|	cytidylate kinase [Streptococcus sp. oral taxon 058] gb|EHI7...
1095741	Streptococcus oralis SK610	1 (0.04%)	5E-75	1-213	1-221	286	45	222	ref|WP_000849410.1|	cytidylate kinase [Streptococcus] gb|EFA24225.1| cytidylate ...
864567	Streptococcus mitis ATCC 6249	1 (0.04%)	1E-74	1-213	1-221	284	45	222	ref|WP_000849391.1|	cytidylate kinase [Streptococcus mitis] gb|EFM30985.1| cytid...
864570	Streptococcus sp. oral taxon 071 str. 73H25AP	1 (0.04%)	1E-75	1-215	1-223	288	44	224	ref|WP_000849407.1|	cytidylate kinase [Streptococcus sp. oral taxon 071] gb|EFM3...
936580	Streptococcus sp. CM6	1 (0.04%)	2E-75	1-213	1-221	288	44	222	gb|EUC81304.1|	cytidylate kinase [Streptococcus sp. CM6]
1333865	Streptococcus tigurinus 2426	1 (0.04%)	3E-75	1-213	1-221	287	44	222	ref|WP_007521259.1|	cytidylate kinase [Streptococcus tigurinus] gb|EMG34272.1| c...
1161421	Streptococcus oralis SK304	1 (0.04%)	4E-75	1-213	1-221	286	44	222	ref|WP_000849409.1|	cytidylate kinase [Streptococcus oralis] gb|EGL90552.1| cyti...
1282664	Streptococcus tigurinus AZ_3a	1 (0.04%)	6E-75	1-213	1-221	286	44	222	ref|WP_007517025.1|	cytidylate kinase [Streptococcus tigurinus] gb|EMG33332.1| c...