| Features and Secondary Structure |
| | 1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 |
| | MYKSVINIVLFCPEIPNNTGNIVRSCTAFKANLHLIKPYGFFLNDKRMVRAGLNCWDKIQLFEHKSWEHFLQATTENKTIWLLTKSGDKTPDQICMTNKLPNELYFVFGQETKGLPKTIMDNFKQNQIRIPIWNSVRSINLANAVVCILYEYSKQNQYSNLDKQCA |
| tmhmm (0) | ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| low complexity (0%) | ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| coiled-coils (0%) | ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| disordered (5%) | XXX-------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXX |
| psipred | -----EEEEEE-------HHHHHHHHHHH---EEEE---------HHHHHHH--HHHH---EEE--HHHHHHHHHH---EEEEEE-------HHHHHH-----EEEEE--------HHHHHH---EEEEE--------HHHHHHHHHHHHHHHH------------ |
PSI-BLAST Sequence Hits (Top 20 by Identity) ALL DATA
|
| TaxID |
Species |
Alignments |
PSI-Blast Data (alignment with lowest E value) |
| E value |
Query Span |
Sbjct Span |
Bit Score |
Identity |
HSP Length |
Accession |
Description |
| 662947 | Mycoplasma genitalium M2288 | 1 (0.03%) | 1E-47 | 1-166 | 1-166 | 194 | 99 | 166 | ref|YP_006601389.1| | RNA methyltransferase [Mycoplasma genitalium M2288] ref|WP_0... |
| 562983 | Gemella sanguinis M325 | 1 (0.03%) | 1E-53 | 5-162 | 1-157 | 214 | 45 | 158 | ref|WP_006365059.1| | RNA methyltransferase [Gemella sanguinis] gb|EGF85940.1| RNA... |
| 562982 | Gemella morbillorum M424 | 1 (0.03%) | 1E-53 | 5-162 | 1-157 | 214 | 45 | 158 | ref|WP_004632021.1| | RNA methyltransferase [Gemella morbillorum] gb|EFV36147.1| R... |
| 166939 | Allofustis seminis | 1 (0.03%) | 1E-51 | 5-163 | 1-158 | 208 | 44 | 160 | ref|WP_018658726.1| | hypothetical protein [Allofustis seminis] |
| 546270 | Gemella haemolysans ATCC 10379 | 2 (0.05%) | 4E-54 | 5-162 | 1-157 | 216 | 43 | 158 | ref|WP_003145689.1| | RNA methyltransferase [Gemella haemolysans] gb|EER68136.1| R... |
| 562981 | Gemella haemolysans M341 | 1 (0.03%) | 8E-54 | 5-162 | 1-157 | 215 | 43 | 158 | ref|WP_003146029.1| | RNA methyltransferase [Gemella haemolysans] gb|EGF87331.1| h... |
| 574087 | Acetohalobium arabaticum DSM 5501 | 2 (0.05%) | 6E-53 | 6-161 | 1-151 | 212 | 43 | 156 | ref|YP_003828465.1| | TrmH family RNA methyltransferase [Acetohalobium arabaticum ... |
| 1321820 | Gemella bergeriae ATCC 700627 | 1 (0.03%) | 2E-52 | 5-161 | 1-156 | 210 | 43 | 157 | ref|WP_021752861.1| | RNA methyltransferase, TrmH family, group 2 [Gemella bergeri... |
| 1212545 | Staphylococcus arlettae CVD059 | 1 (0.03%) | 5E-51 | 7-161 | 4-155 | 205 | 43 | 155 | ref|WP_002509221.1| | RNA methyltransferase [Staphylococcus] gb|EJY96400.1| rRNA m... |
| 1231389 | Streptococcus agalactiae SA20-06 | 1 (0.03%) | 4E-49 | 7-162 | 19-171 | 199 | 43 | 157 | ref|YP_006951698.1| | tRNA (cytidine(34)-2`-O)-methyltransferase [Streptococcus ag... |
| 391592 | Caminibacter mediatlanticus TB-2 | 3 (0.07%) | 5E-45 | 5-156 | 1-147 | 186 | 43 | 152 | ref|WP_007473878.1| | RNA methyltransferase [Caminibacter mediatlanticus] gb|EDM23... |
| 710128 | Mycoplasma gallisepticum str. R(high) | 1 (0.03%) | 9E-45 | 4-162 | 3-163 | 185 | 43 | 161 | ref|NP_853100.2| | SpoU class rRNA methylase [Mycoplasma gallisepticum str. R(l... |
| 708616 | Mycoplasma gallisepticum str. F | 1 (0.03%) | 3E-44 | 4-162 | 3-163 | 183 | 43 | 161 | ref|YP_005880790.1| | SpoU class rRNA methylase [Mycoplasma gallisepticum str. F] ... |
| 1198133 | Myxococcus xanthus DZ2 | 1 (0.03%) | 4E-17 | 4-59 | 7-62 | 94 | 43 | 56 | gb|AAF81066.1|AF223364_1 | tRNA/rRNA methyltransferase-like protein [Myxococcus xanthus... |
| 458233 | Macrococcus caseolyticus JCSC5402 | 2 (0.05%) | 8E-55 | 4-162 | 2-157 | 218 | 42 | 159 | ref|YP_002560984.1| | SpoU rRNA methylase family protein [Macrococcus caseolyticus... |
| 42858 | Staphylococcus lentus | 1 (0.03%) | 1E-53 | 7-162 | 4-157 | 214 | 42 | 156 | ref|WP_016999957.1| | RNA methyltransferase [Staphylococcus lentus] |
| 1296619 | Staphylococcus capitis CR01 | 1 (0.03%) | 7E-53 | 7-162 | 4-156 | 212 | 42 | 156 | ref|WP_023350044.1| | tRNA (cytidine(34)-2'-O)-methyltransferase TrmL [Staphylococ... |
| 904334 | Staphylococcus capitis VCU116 | 1 (0.03%) | 6E-53 | 7-162 | 4-156 | 212 | 42 | 156 | ref|WP_002434802.1| | RNA methyltransferase [Staphylococcus capitis] gb|EEE49175.1... |
| 29380 | Staphylococcus caprae | 2 (0.05%) | 5E-52 | 7-162 | 4-156 | 209 | 42 | 156 | ref|WP_002443570.1| | RNA methyltransferase [Staphylococcus caprae] gb|EES39831.1|... |
| 155680 | Streptococcus entericus | 1 (0.03%) | 4E-52 | 7-162 | 6-158 | 209 | 42 | 157 | ref|WP_018367531.1| | RNA methyltransferase [Streptococcus entericus] |