old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160
	MYKSVINIVLFCPEIPNNTGNIVRSCTAFKANLHLIKPYGFFLNDKRMVRAGLNCWDKIQLFEHKSWEHFLQATTENKTIWLLTKSGDKTPDQICMTNKLPNELYFVFGQETKGLPKTIMDNFKQNQIRIPIWNSVRSINLANAVVCILYEYSKQNQYSNLDKQCA
tmhmm (0)	----------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)	----------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	----------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (5%)	XXX-------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXX
psipred	-----EEEEEE-------HHHHHHHHHHH---EEEE---------HHHHHHH--HHHH---EEE--HHHHHHHHHH---EEEEEE-------HHHHHH-----EEEEE--------HHHHHH---EEEEE--------HHHHHHHHHHHHHHHH------------

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    31	    0.130
  max. Y    22	    0.177
  max. S    15	    0.307
  mean S     1-21   0.244
       D     1-21   0.203    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.203 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-166	alignment	3l8uA_202	1-154	0.8544	TRANSFERASE

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
662947	Mycoplasma genitalium M2288	1 (0.03%)	1E-47	1-166	1-166	194	99	166	ref|YP_006601389.1|	RNA methyltransferase [Mycoplasma genitalium M2288] ref|WP_0...
562983	Gemella sanguinis M325	1 (0.03%)	1E-53	5-162	1-157	214	45	158	ref|WP_006365059.1|	RNA methyltransferase [Gemella sanguinis] gb|EGF85940.1| RNA...
562982	Gemella morbillorum M424	1 (0.03%)	1E-53	5-162	1-157	214	45	158	ref|WP_004632021.1|	RNA methyltransferase [Gemella morbillorum] gb|EFV36147.1| R...
166939	Allofustis seminis	1 (0.03%)	1E-51	5-163	1-158	208	44	160	ref|WP_018658726.1|	hypothetical protein [Allofustis seminis]
546270	Gemella haemolysans ATCC 10379	2 (0.05%)	4E-54	5-162	1-157	216	43	158	ref|WP_003145689.1|	RNA methyltransferase [Gemella haemolysans] gb|EER68136.1| R...
562981	Gemella haemolysans M341	1 (0.03%)	8E-54	5-162	1-157	215	43	158	ref|WP_003146029.1|	RNA methyltransferase [Gemella haemolysans] gb|EGF87331.1| h...
574087	Acetohalobium arabaticum DSM 5501	2 (0.05%)	6E-53	6-161	1-151	212	43	156	ref|YP_003828465.1|	TrmH family RNA methyltransferase [Acetohalobium arabaticum ...
1321820	Gemella bergeriae ATCC 700627	1 (0.03%)	2E-52	5-161	1-156	210	43	157	ref|WP_021752861.1|	RNA methyltransferase, TrmH family, group 2 [Gemella bergeri...
1212545	Staphylococcus arlettae CVD059	1 (0.03%)	5E-51	7-161	4-155	205	43	155	ref|WP_002509221.1|	RNA methyltransferase [Staphylococcus] gb|EJY96400.1| rRNA m...
1231389	Streptococcus agalactiae SA20-06	1 (0.03%)	4E-49	7-162	19-171	199	43	157	ref|YP_006951698.1|	tRNA (cytidine(34)-2`-O)-methyltransferase [Streptococcus ag...
391592	Caminibacter mediatlanticus TB-2	3 (0.07%)	5E-45	5-156	1-147	186	43	152	ref|WP_007473878.1|	RNA methyltransferase [Caminibacter mediatlanticus] gb|EDM23...
710128	Mycoplasma gallisepticum str. R(high)	1 (0.03%)	9E-45	4-162	3-163	185	43	161	ref|NP_853100.2|	SpoU class rRNA methylase [Mycoplasma gallisepticum str. R(l...
708616	Mycoplasma gallisepticum str. F	1 (0.03%)	3E-44	4-162	3-163	183	43	161	ref|YP_005880790.1|	SpoU class rRNA methylase [Mycoplasma gallisepticum str. F] ...
1198133	Myxococcus xanthus DZ2	1 (0.03%)	4E-17	4-59	7-62	94	43	56	gb|AAF81066.1|AF223364_1	tRNA/rRNA methyltransferase-like protein [Myxococcus xanthus...
458233	Macrococcus caseolyticus JCSC5402	2 (0.05%)	8E-55	4-162	2-157	218	42	159	ref|YP_002560984.1|	SpoU rRNA methylase family protein [Macrococcus caseolyticus...
42858	Staphylococcus lentus	1 (0.03%)	1E-53	7-162	4-157	214	42	156	ref|WP_016999957.1|	RNA methyltransferase [Staphylococcus lentus]
1296619	Staphylococcus capitis CR01	1 (0.03%)	7E-53	7-162	4-156	212	42	156	ref|WP_023350044.1|	tRNA (cytidine(34)-2'-O)-methyltransferase TrmL [Staphylococ...
904334	Staphylococcus capitis VCU116	1 (0.03%)	6E-53	7-162	4-156	212	42	156	ref|WP_002434802.1|	RNA methyltransferase [Staphylococcus capitis] gb|EEE49175.1...
29380	Staphylococcus caprae	2 (0.05%)	5E-52	7-162	4-156	209	42	156	ref|WP_002443570.1|	RNA methyltransferase [Staphylococcus caprae] gb|EES39831.1|...
155680	Streptococcus entericus	1 (0.03%)	4E-52	7-162	6-158	209	42	157	ref|WP_018367531.1|	RNA methyltransferase [Streptococcus entericus]