old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280 . 290 . 300 . 310 . 320 . 330 .
	MIGAKTRVAIVGGIGYIGSCFASFIKEQNDKLIVTVIDNNKNNHVIKLLKKIGIEFYFADLLDRHKLTEVIAAIQPDVVFHFAAKTSVSESVHNPLKYFDCNVIGTLNLISAISNLQKPIKLFFASSAAVYGQTTNSYISEEIVITETQATNPYGLSKFLDELILNAVAKNSQLQVVCLRFFNVAGAILPFGNFNGNTTLLIPNLVKAFLKQTPFFLYGNDYATKDGSCIRDYIHVYDICNAHFLLWKWLNDHRQIKFETFNLGSGIGTSNLEVIDIAKKVFYPSRLNLEIRPKRSWDPAILVANVAKAKQTFQFKITRNLKDMISDERNFYENFYNDAY
tmhmm (0)	----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)	----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (5%)	XXXXX--XXX---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXX
psipred	------EEEEE----HHHHHHHHHHHH---EEEEEEE-----HHHHHH------EEEEEE---HHHHHHHHHH----EEEE------HHHHHHHHHHHHHHHHHHHHHHHHHHHHH----EEEEE---------------------------HHHHHHHHHHHHHHHHHHHH---EEEE--------------------HHHHHHHHHHH-----EEE----------EEE--EEHHHHHHHHHHHHHHHHH-------EEE------EEHHHHHHHHHHHH-------EE--------------HHHHHHHH-------HHHHHHHHHHHHHH------

# SignalP-4.0 gram- predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    23	    0.230
  max. Y    23	    0.279
  max. S    22	    0.597
  mean S     1-22   0.292
       D     1-22   0.285    0.570  NO
Name=tmp_signalp_seq	SP='NO' D=0.285 D-cutoff=0.570 Networks=SignalP-noTM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-340	alignment	3enkA_204	1-340	0.8578	ISOMERASE

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
632516	Caldicellulosiruptor lactoaceticus 6A	1 (0.03%)	1E-101	8-338	2-324	375	39	335	ref|YP_004026072.1|	udp-glucose 4-epimerase [Caldicellulosiruptor kristjanssonii...
521460	Caldicellulosiruptor bescii DSM 6725	2 (0.05%)	1E-101	8-338	2-324	374	39	335	ref|YP_002572818.1|	UDP-glucose 4-epimerase [Caldicellulosiruptor bescii DSM 672...
632292	Caldicellulosiruptor hydrothermalis 108	1 (0.03%)	1E-100	8-338	2-324	372	39	335	ref|YP_003992850.1|	udp-glucose 4-epimerase [Caldicellulosiruptor hydrothermalis...
351627	Caldicellulosiruptor saccharolyticus DSM 8903	1 (0.03%)	1E-102	8-338	2-324	377	38	335	ref|YP_001180296.1|	UDP-glucose 4-epimerase [Caldicellulosiruptor saccharolyticu...
632518	Caldicellulosiruptor owensensis OL	1 (0.03%)	1E-101	8-338	2-324	376	38	335	ref|YP_004002118.1|	udp-glucose 4-epimerase [Caldicellulosiruptor owensensis OL]...
608506	Caldicellulosiruptor obsidiansis OB47	1 (0.03%)	1E-101	8-338	2-324	375	38	335	ref|YP_003840824.1|	UDP-glucose 4-epimerase [Caldicellulosiruptor obsidiansis OB...
632348	Caldicellulosiruptor kronotskyensis 2002	1 (0.03%)	1E-100	8-338	2-324	372	38	335	ref|YP_004024403.1|	udp-glucose 4-epimerase [Caldicellulosiruptor kronotskyensis...
324057	Paenibacillus sp. JDR-2	4 (0.1%)	1E-104	6-338	4-328	386	37	337	ref|YP_003009774.1|	UDP-glucose 4-epimerase [Paenibacillus sp. JDR-2] ref|WP_015...
1204474	Fusobacterium nucleatum CTI-1	1 (0.03%)	1E-102	6-338	1-326	376	37	337	ref|WP_008702684.1|	UDP-glucose 4-epimerase [Fusobacterium nucleatum] gb|EEO4368...
868595	Desulfotomaculum carboxydivorans CO-1-SRB	1 (0.03%)	1E-101	6-335	1-322	375	37	334	ref|YP_004496556.1|	UDP-glucose 4-epimerase [Desulfotomaculum carboxydivorans CO...
620833	Fusobacterium periodonticum D10	1 (0.03%)	1E-101	6-338	1-326	374	37	337	ref|WP_005964991.1|	UDP-glucose 4-epimerase [Fusobacterium periodonticum] gb|EKA...
654421	Anoxybacillus sp. SK3-4	1 (0.03%)	1E-101	8-332	2-318	374	37	328	ref|WP_021095803.1|	UDP-glucose 4-epimerase [Anoxybacillus sp. SK3-4] gb|EPZ3744...
1297579	Fusobacterium nucleatum CC53	1 (0.03%)	1E-100	6-338	1-326	373	37	337	ref|YP_008475664.1|	UDP-glucose 4-epimerase [Fusobacterium nucleatum subsp. vinc...
1032505	Fusobacterium sp. OBRC1	1 (0.03%)	1E-100	6-338	1-326	373	37	337	gb|EUB38118.1|	UDP-glucose 4-epimerase GalE [Fusobacterium sp. OBRC1]
936562	Fusobacterium sp. CM21	2 (0.05%)	1E-101	6-338	1-326	373	37	337	gb|ETT06798.1|	UDP-glucose 4-epimerase GalE [Fusobacterium sp. CM21]
748727	Clostridium ljungdahlii DSM 13528	1 (0.03%)	7E-97	6-335	1-322	360	37	334	ref|YP_003780333.1|	UDP-glucose 4-epimerase [Clostridium ljungdahlii DSM 13528] ...
209882	Fusobacterium nucleatum subsp. vincentii ATCC 49256	2 (0.05%)	9E-94	6-326	1-314	350	37	325	ref|WP_005888886.1|	UDP-glucose 4-epimerase [Fusobacterium nucleatum] gb|EAA2473...
111823	Caldanaerobacter subterraneus	1 (0.03%)	1E-106	6-338	1-325	390	36	337	ref|WP_022588470.1|	UDP-glucose 4-epimerase [Caldanaerobacter subterraneus] gb|E...
1202533	Bacillus nealsonii AAU1	1 (0.03%)	1E-104	6-338	1-326	386	36	337	ref|WP_016204368.1|	UDP-glucose 4-epimerase GalE [Bacillus nealsonii] gb|EOR2223...
1262769	Clostridium sp. CAG:1013	2 (0.05%)	1E-104	6-338	1-326	383	36	337	ref|WP_016405210.1|	uDP-glucose 4-epimerase [Clostridium sp. CAG:1013] emb|CCX37...