old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 .
	MLIAIVGKPGVGKTSLLQYLKDNYHFSVFYADSFIHEQYQKNNPGYQLIMDHFGKEFVNQTEVDRKKLANYVFSDDKLIEKLSLVTKPLLIAWIKSLKTQFQKKLALIEIAVMLNYWNEYRSLFDYVIKLERDDQLVNLALQQRNSHKKVKDLIKEPNCKIDTIFNNDSIATAALKLIKLLETFLERNKCRCDCCHIQ
tmhmm (0)	------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (6%)	-------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXXXXX-----------------
coiled-coils (0%)	------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (13%)	-----------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXXXXXXXXXXXXXXXX--------------------------------X----X
psipred	-EEEEE------HHHHHHHHHHH---EEEE--HHHHHHHH--HHHHHHHHHHHHHHH-------HHHHHHHHH--HHHHHHHHH---HHHHHHHHHHHHH-----EEEEEE---HHH--------EEEEEE--HHHHHHHHH----HHHHHHHHHHHHH---EEEE----HHHHHHHHHHHHHHHHHHH---------

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    32	    0.114
  max. Y     3	    0.166
  max. S     2	    0.318
  mean S     1-2    0.299
       D     1-2    0.218    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.218 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-198	alignment	1vhlA_304	1-208	0.6608	Transferase

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
347257	Mycoplasma agalactiae PG2	1 (0.03%)	8E-16	2-159	1-151	90	28	158	ref|YP_001256804.1|	hypothetical protein MAG_6660 [Mycoplasma agalactiae PG2] re...
572479	Halanaerobium praevalens DSM 2228	1 (0.03%)	3E-47	1-186	1-195	194	27	196	ref|YP_005836756.1|	dephospho-CoA kinase [Halanaerobium praevalens DSM 2228] ref...
1293054	Halanaerobium saccharolyticum subsp. saccharolyticum DSM 6643	1 (0.03%)	2E-51	1-186	1-195	207	26	196	ref|WP_005487359.1|	Methylglyoxal synthase [Halanaerobium saccharolyticum] emb|C...
888064	Enterococcus italicus DSM 15952	1 (0.03%)	1E-46	2-186	4-198	192	26	196	ref|WP_007208227.1|	dephospho-CoA kinase [Enterococcus italicus] gb|EFU74031.1| ...
509192	Thermoanaerobacter ethanolicus JW 200	1 (0.03%)	1E-44	2-180	3-191	185	26	190	ref|WP_003871278.1|	dephospho-CoA kinase [Thermoanaerobacter ethanolicus] gb|EGD...
580327	Thermoanaerobacterium thermosaccharolyticum DSM 571	1 (0.03%)	3E-41	2-182	3-193	173	26	192	ref|YP_003851707.1|	dephospho-CoA kinase [Thermoanaerobacterium thermosaccharoly...
441768	Acholeplasma laidlawii PG-8A	1 (0.03%)	1E-37	2-184	269-451	162	26	192	ref|YP_001620349.1|	bifunctional formamidopyrimidine-DNA glycosylase/dephospho-C...
498738	Borrelia burgdorferi 29805	1 (0.03%)	4E-23	1-141	6-142	113	26	142	ref|WP_002663497.1|	dephospho-CoA kinase [Borrelia burgdorferi] gb|EEH32794.1| d...
498739	Borrelia burgdorferi CA-11.2a	1 (0.03%)	4E-23	1-142	6-143	113	26	143	ref|WP_002664779.1|	dephospho-CoA kinase [Borrelia burgdorferi] gb|EEF83629.1| d...
521007	Borrelia burgdorferi N40	1 (0.03%)	4E-23	1-142	6-143	113	26	143	ref|YP_002375053.1|	dephospho-CoA kinase [Borrelia burgdorferi ZS7] ref|YP_00580...
575788	Vibrio splendidus LGP32	2 (0.06%)	1E-21	1-77	3-80	109	26	78	ref|YP_002418133.1|	dephospho-CoA kinase [Vibrio splendidus LGP32] ref|WP_012604...
1134413	Bacillus sp. L1(2012)	1 (0.03%)	1E-54	1-184	1-194	218	25	195	ref|WP_017726621.1|	hypothetical protein [Bacillus sp. L1(2012)]
373903	Halothermothrix orenii H 168	1 (0.03%)	1E-52	1-190	1-198	212	25	199	ref|YP_002508242.1|	dephospho-CoA kinase [Halothermothrix orenii H 168] ref|WP_0...
391606	Carboxydibrachium pacificum DSM 12653	1 (0.03%)	2E-48	2-188	3-198	197	25	197	ref|NP_622527.1|	dephospho-CoA kinase [Thermoanaerobacter tengcongensis MB4] ...
760142	Hippea maritima DSM 10411	1 (0.03%)	2E-44	3-184	4-196	184	25	194	ref|YP_004340585.1|	dephospho-CoA kinase [Hippea maritima DSM 10411] ref|WP_0136...
1094508	Thermoanaerobacterium saccharolyticum JW/SL-YS485	1 (0.03%)	4E-43	2-182	4-194	180	25	192	ref|YP_006392747.1|	dephospho-CoA kinase [Thermoanaerobacterium saccharolyticum ...
742765	Dorea formicigenerans 4_6_53AFAA	1 (0.03%)	8E-43	2-184	3-196	179	25	194	ref|WP_005332574.1|	dephospho-CoA kinase [Dorea] gb|EDR46960.1| dephospho-CoA ki...
500633	Clostridium hiranonis DSM 13275	1 (0.03%)	3E-42	1-187	11-205	177	25	197	ref|WP_006440808.1|	dephospho-CoA kinase [[Clostridium] hiranonis] gb|EEA84406.1...
649757	Anaerostipes hadrus DSM 3319	1 (0.03%)	2E-41	2-181	3-194	175	25	192	ref|YP_007790866.1|	dephospho-CoA kinase [butyrate-producing bacterium SSC/2] re...
7029	Acyrthosiphon pisum	1 (0.03%)	9E-41	2-196	318-516	172	25	204	ref|XP_001944795.1|	PREDICTED: bifunctional coenzyme A synthase-like isoform 1 [...