| Features and Secondary Structure |
| | 1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . |
| | MLIAIVGKPGVGKTSLLQYLKDNYHFSVFYADSFIHEQYQKNNPGYQLIMDHFGKEFVNQTEVDRKKLANYVFSDDKLIEKLSLVTKPLLIAWIKSLKTQFQKKLALIEIAVMLNYWNEYRSLFDYVIKLERDDQLVNLALQQRNSHKKVKDLIKEPNCKIDTIFNNDSIATAALKLIKLLETFLERNKCRCDCCHIQ |
| tmhmm (0) | ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ |
| low complexity (6%) | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXXXXX----------------- |
| coiled-coils (0%) | ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ |
| disordered (13%) | -----------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXXXXXXXXXXXXXXXX--------------------------------X----X |
| psipred | -EEEEE------HHHHHHHHHHH---EEEE--HHHHHHHH--HHHHHHHHHHHHHHH-------HHHHHHHHH--HHHHHHHHH---HHHHHHHHHHHHH-----EEEEEE---HHH--------EEEEEE--HHHHHHHHH----HHHHHHHHHHHHH---EEEE----HHHHHHHHHHHHHHHHHHH--------- |
PSI-BLAST Sequence Hits (Top 20 by Identity) ALL DATA
|
| TaxID |
Species |
Alignments |
PSI-Blast Data (alignment with lowest E value) |
| E value |
Query Span |
Sbjct Span |
Bit Score |
Identity |
HSP Length |
Accession |
Description |
| 347257 | Mycoplasma agalactiae PG2 | 1 (0.03%) | 8E-16 | 2-159 | 1-151 | 90 | 28 | 158 | ref|YP_001256804.1| | hypothetical protein MAG_6660 [Mycoplasma agalactiae PG2] re... |
| 572479 | Halanaerobium praevalens DSM 2228 | 1 (0.03%) | 3E-47 | 1-186 | 1-195 | 194 | 27 | 196 | ref|YP_005836756.1| | dephospho-CoA kinase [Halanaerobium praevalens DSM 2228] ref... |
| 1293054 | Halanaerobium saccharolyticum subsp. saccharolyticum DSM 6643 | 1 (0.03%) | 2E-51 | 1-186 | 1-195 | 207 | 26 | 196 | ref|WP_005487359.1| | Methylglyoxal synthase [Halanaerobium saccharolyticum] emb|C... |
| 888064 | Enterococcus italicus DSM 15952 | 1 (0.03%) | 1E-46 | 2-186 | 4-198 | 192 | 26 | 196 | ref|WP_007208227.1| | dephospho-CoA kinase [Enterococcus italicus] gb|EFU74031.1| ... |
| 509192 | Thermoanaerobacter ethanolicus JW 200 | 1 (0.03%) | 1E-44 | 2-180 | 3-191 | 185 | 26 | 190 | ref|WP_003871278.1| | dephospho-CoA kinase [Thermoanaerobacter ethanolicus] gb|EGD... |
| 580327 | Thermoanaerobacterium thermosaccharolyticum DSM 571 | 1 (0.03%) | 3E-41 | 2-182 | 3-193 | 173 | 26 | 192 | ref|YP_003851707.1| | dephospho-CoA kinase [Thermoanaerobacterium thermosaccharoly... |
| 441768 | Acholeplasma laidlawii PG-8A | 1 (0.03%) | 1E-37 | 2-184 | 269-451 | 162 | 26 | 192 | ref|YP_001620349.1| | bifunctional formamidopyrimidine-DNA glycosylase/dephospho-C... |
| 498738 | Borrelia burgdorferi 29805 | 1 (0.03%) | 4E-23 | 1-141 | 6-142 | 113 | 26 | 142 | ref|WP_002663497.1| | dephospho-CoA kinase [Borrelia burgdorferi] gb|EEH32794.1| d... |
| 498739 | Borrelia burgdorferi CA-11.2a | 1 (0.03%) | 4E-23 | 1-142 | 6-143 | 113 | 26 | 143 | ref|WP_002664779.1| | dephospho-CoA kinase [Borrelia burgdorferi] gb|EEF83629.1| d... |
| 521007 | Borrelia burgdorferi N40 | 1 (0.03%) | 4E-23 | 1-142 | 6-143 | 113 | 26 | 143 | ref|YP_002375053.1| | dephospho-CoA kinase [Borrelia burgdorferi ZS7] ref|YP_00580... |
| 575788 | Vibrio splendidus LGP32 | 2 (0.06%) | 1E-21 | 1-77 | 3-80 | 109 | 26 | 78 | ref|YP_002418133.1| | dephospho-CoA kinase [Vibrio splendidus LGP32] ref|WP_012604... |
| 1134413 | Bacillus sp. L1(2012) | 1 (0.03%) | 1E-54 | 1-184 | 1-194 | 218 | 25 | 195 | ref|WP_017726621.1| | hypothetical protein [Bacillus sp. L1(2012)] |
| 373903 | Halothermothrix orenii H 168 | 1 (0.03%) | 1E-52 | 1-190 | 1-198 | 212 | 25 | 199 | ref|YP_002508242.1| | dephospho-CoA kinase [Halothermothrix orenii H 168] ref|WP_0... |
| 391606 | Carboxydibrachium pacificum DSM 12653 | 1 (0.03%) | 2E-48 | 2-188 | 3-198 | 197 | 25 | 197 | ref|NP_622527.1| | dephospho-CoA kinase [Thermoanaerobacter tengcongensis MB4] ... |
| 760142 | Hippea maritima DSM 10411 | 1 (0.03%) | 2E-44 | 3-184 | 4-196 | 184 | 25 | 194 | ref|YP_004340585.1| | dephospho-CoA kinase [Hippea maritima DSM 10411] ref|WP_0136... |
| 1094508 | Thermoanaerobacterium saccharolyticum JW/SL-YS485 | 1 (0.03%) | 4E-43 | 2-182 | 4-194 | 180 | 25 | 192 | ref|YP_006392747.1| | dephospho-CoA kinase [Thermoanaerobacterium saccharolyticum ... |
| 742765 | Dorea formicigenerans 4_6_53AFAA | 1 (0.03%) | 8E-43 | 2-184 | 3-196 | 179 | 25 | 194 | ref|WP_005332574.1| | dephospho-CoA kinase [Dorea] gb|EDR46960.1| dephospho-CoA ki... |
| 500633 | Clostridium hiranonis DSM 13275 | 1 (0.03%) | 3E-42 | 1-187 | 11-205 | 177 | 25 | 197 | ref|WP_006440808.1| | dephospho-CoA kinase [[Clostridium] hiranonis] gb|EEA84406.1... |
| 649757 | Anaerostipes hadrus DSM 3319 | 1 (0.03%) | 2E-41 | 2-181 | 3-194 | 175 | 25 | 192 | ref|YP_007790866.1| | dephospho-CoA kinase [butyrate-producing bacterium SSC/2] re... |
| 7029 | Acyrthosiphon pisum | 1 (0.03%) | 9E-41 | 2-196 | 318-516 | 172 | 25 | 204 | ref|XP_001944795.1| | PREDICTED: bifunctional coenzyme A synthase-like isoform 1 [... |