| Features and Secondary Structure |
| | 1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280 |
| | MKQYLDLASYVLANGKKRKNRTDTDTLSVFGYQMKFDLTNSFPLLTTKKVNWKAIVHELLWFIKGDTNIKYLVDNGVNIWNEWPYENFKKSPSFQNETLQEFILKVKTDNEFAKQFADLGPVYGKQWRNFNGVDQLKKVIQEIKENPNSRRLIVSSWNPSELEKMALAPCHSLFQFYVEEDKLSLQLYQRSGDIFLGVPFNIASYALLVYLVAHETKLKPGYFIHTLGDAHIYENHIEQIKLQLTRTTLDPPQVVLKSDKSIFAYSFDDIELVGYNYHPFIYGRVAV |
| tmhmm (0) | ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| low complexity (0%) | ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| coiled-coils (0%) | ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| disordered (0%) | X---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| psipred | -HHHHHHHHHHHHH--EE-------EEEE----EEE------EE-------HHHHHHHHHHHHH----HHHHHHH---EE-----------------HHHHHHHH------------------EEE-----HHHHHHHHHHHHH------EEEEE---HHHHH--------EEEEEEEE----EEEEEE-------HH---HHHHHHHHHHHHHH-----EEEEEEEE--EEEHHHHHHHHHHH--------EEEE----------HHHEEEE-------------- |
PSI-BLAST Sequence Hits (Top 20 by Identity) ALL DATA
|
| TaxID |
Species |
Alignments |
PSI-Blast Data (alignment with lowest E value) |
| E value |
Query Span |
Sbjct Span |
Bit Score |
Identity |
HSP Length |
Accession |
Description |
| 662947 | Mycoplasma genitalium M2288 | 1 (0.03%) | 1E-114 | 1-287 | 1-287 | 416 | 100 | 287 | ref|NP_072893.1| | thymidylate synthase [Mycoplasma genitalium G37] ref|YP_0065... |
| 1112856 | Mycoplasma pneumoniae 309 | 1 (0.03%) | 1E-116 | 1-287 | 42-328 | 423 | 74 | 287 | ref|YP_005175559.1| | thymidylate synthase [Mycoplasma pneumoniae 309] ref|WP_0143... |
| 1238993 | Mycoplasma pneumoniae M129-B7 | 1 (0.03%) | 1E-115 | 1-287 | 1-287 | 420 | 74 | 287 | ref|NP_110008.2| | thymidylate synthase [Mycoplasma pneumoniae M129] ref|YP_005... |
| 936139 | Mycoplasma hyorhinis MCLD | 1 (0.03%) | 1E-101 | 1-263 | 1-261 | 373 | 67 | 263 | ref|YP_005905065.1| | thymidylate synthase [Mycoplasma hyorhinis MCLD] ref|WP_0145... |
| 2107 | Mycoplasma pulmonis | 1 (0.03%) | 1E-113 | 1-287 | 1-286 | 414 | 66 | 287 | ref|NP_326369.1| | thymidylate synthase [Mycoplasma pulmonis UAB CTIP] ref|WP_0... |
| 1276221 | Spiroplasma diminutum CUAS-1 | 1 (0.03%) | 1E-113 | 1-287 | 1-289 | 414 | 66 | 289 | ref|YP_008292707.1| | thymidylate synthase [Spiroplasma diminutum CUAS-1] ref|WP_0... |
| 634997 | Mycoplasma hyorhinis DBS 1050 | 1 (0.03%) | 1E-111 | 1-287 | 1-286 | 407 | 65 | 287 | ref|YP_003856649.1| | Thymidylate synthase 2 [Mycoplasma hyorhinis HUB-1] ref|YP_0... |
| 61635 | Acholeplasma brassicae | 1 (0.03%) | 1E-120 | 1-287 | 1-288 | 437 | 64 | 288 | emb|CCV65800.1| | Thymidylate synthase [Acholeplasma brassicae] |
| 1276227 | Spiroplasma chrysopicola DF-1 | 1 (0.03%) | 1E-116 | 1-287 | 1-289 | 425 | 64 | 289 | ref|YP_008017710.1| | thymidylate synthase [Spiroplasma chrysopicola DF-1] ref|WP_... |
| 1159204 | Mycoplasma gallisepticum NC08_2008.031-4-3P | 1 (0.03%) | 1E-114 | 1-287 | 1-289 | 419 | 64 | 289 | ref|NP_852828.1| | thymidylate synthase [Mycoplasma gallisepticum str. R(low)] ... |
| 1006581 | Mycoplasma gallisepticum S6 | 1 (0.03%) | 1E-113 | 1-287 | 1-289 | 415 | 64 | 289 | ref|YP_008893990.1| | thymidylate synthase [Mycoplasma gallisepticum S6] ref|WP_01... |
| 1276246 | Spiroplasma culicicola AES-1 | 1 (0.03%) | 1E-113 | 1-287 | 1-289 | 415 | 64 | 289 | gb|AHI53100.1| | thymidylate synthase [Spiroplasma culicicola AES-1] |
| 2096 | Mycoplasma gallisepticum | 1 (0.03%) | 1E-112 | 1-287 | 1-289 | 412 | 64 | 289 | gb|AAD45276.1|AF152114_4 | thymidylate synthase [Mycoplasma gallisepticum] |
| 1276220 | Spiroplasma taiwanense CT-1 | 1 (0.03%) | 1E-112 | 1-287 | 1-289 | 409 | 64 | 289 | ref|YP_008311732.1| | thymidylate synthase [Spiroplasma taiwanense CT-1] ref|WP_02... |
| 340016 | uncultured virus | 1 (0.03%) | 9E-8 | 118-167 | 10-59 | 64 | 64 | 50 | gb|ACE75860.1| | putative thymidylate synthase-like protein [uncultured virus... |
| 1276229 | Spiroplasma syrphidicola EA-1 | 1 (0.03%) | 1E-117 | 1-287 | 1-289 | 428 | 63 | 289 | ref|YP_008026477.1| | thymidylate synthase [Spiroplasma syrphidicola EA-1] ref|WP_... |
| 1276258 | Spiroplasma apis B31 | 1 (0.03%) | 1E-115 | 1-287 | 1-289 | 420 | 63 | 289 | ref|YP_008868869.1| | thymidylate synthase [Spiroplasma apis B31] ref|WP_023789786... |
| 265311 | Mesoplasma florum L1 | 1 (0.03%) | 1E-112 | 1-287 | 1-288 | 412 | 63 | 288 | ref|YP_053662.1| | thymidylate synthase [Mesoplasma florum L1] ref|WP_011183318... |
| 272633 | Mycoplasma penetrans HF-2 | 1 (0.03%) | 1E-108 | 1-287 | 1-289 | 399 | 63 | 289 | ref|NP_758075.1| | thymidylate synthase [Mycoplasma penetrans HF-2] ref|WP_0110... |
| 1276257 | Spiroplasma sabaudiense Ar-1343 | 1 (0.03%) | 1E-108 | 1-287 | 1-289 | 398 | 63 | 289 | gb|AHI53991.1| | thymidylate synthase [Spiroplasma sabaudiense Ar-1343] |