old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280
	MKQYLDLASYVLANGKKRKNRTDTDTLSVFGYQMKFDLTNSFPLLTTKKVNWKAIVHELLWFIKGDTNIKYLVDNGVNIWNEWPYENFKKSPSFQNETLQEFILKVKTDNEFAKQFADLGPVYGKQWRNFNGVDQLKKVIQEIKENPNSRRLIVSSWNPSELEKMALAPCHSLFQFYVEEDKLSLQLYQRSGDIFLGVPFNIASYALLVYLVAHETKLKPGYFIHTLGDAHIYENHIEQIKLQLTRTTLDPPQVVLKSDKSIFAYSFDDIELVGYNYHPFIYGRVAV
tmhmm (0)	-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)	-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (0%)	X----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
psipred	-HHHHHHHHHHHHH--EE-------EEEE----EEE------EE-------HHHHHHHHHHHHH----HHHHHHH---EE-----------------HHHHHHHH------------------EEE-----HHHHHHHHHHHHH------EEEEE---HHHHH--------EEEEEEEE----EEEEEE-------HH---HHHHHHHHHHHHHH-----EEEEEEEE--EEEHHHHHHHHHHH--------EEEE----------HHHEEEE--------------

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    21	    0.107
  max. Y    16	    0.144
  max. S    12	    0.268
  mean S     1-15   0.204
       D     1-15   0.167    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.167 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-287	alignment	1bp6A_201	1-316	0.9747	TRANSFERASE

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
662947	Mycoplasma genitalium M2288	1 (0.03%)	1E-114	1-287	1-287	416	100	287	ref|NP_072893.1|	thymidylate synthase [Mycoplasma genitalium G37] ref|YP_0065...
1112856	Mycoplasma pneumoniae 309	1 (0.03%)	1E-116	1-287	42-328	423	74	287	ref|YP_005175559.1|	thymidylate synthase [Mycoplasma pneumoniae 309] ref|WP_0143...
1238993	Mycoplasma pneumoniae M129-B7	1 (0.03%)	1E-115	1-287	1-287	420	74	287	ref|NP_110008.2|	thymidylate synthase [Mycoplasma pneumoniae M129] ref|YP_005...
936139	Mycoplasma hyorhinis MCLD	1 (0.03%)	1E-101	1-263	1-261	373	67	263	ref|YP_005905065.1|	thymidylate synthase [Mycoplasma hyorhinis MCLD] ref|WP_0145...
2107	Mycoplasma pulmonis	1 (0.03%)	1E-113	1-287	1-286	414	66	287	ref|NP_326369.1|	thymidylate synthase [Mycoplasma pulmonis UAB CTIP] ref|WP_0...
1276221	Spiroplasma diminutum CUAS-1	1 (0.03%)	1E-113	1-287	1-289	414	66	289	ref|YP_008292707.1|	thymidylate synthase [Spiroplasma diminutum CUAS-1] ref|WP_0...
634997	Mycoplasma hyorhinis DBS 1050	1 (0.03%)	1E-111	1-287	1-286	407	65	287	ref|YP_003856649.1|	Thymidylate synthase 2 [Mycoplasma hyorhinis HUB-1] ref|YP_0...
61635	Acholeplasma brassicae	1 (0.03%)	1E-120	1-287	1-288	437	64	288	emb|CCV65800.1|	Thymidylate synthase [Acholeplasma brassicae]
1276227	Spiroplasma chrysopicola DF-1	1 (0.03%)	1E-116	1-287	1-289	425	64	289	ref|YP_008017710.1|	thymidylate synthase [Spiroplasma chrysopicola DF-1] ref|WP_...
1159204	Mycoplasma gallisepticum NC08_2008.031-4-3P	1 (0.03%)	1E-114	1-287	1-289	419	64	289	ref|NP_852828.1|	thymidylate synthase [Mycoplasma gallisepticum str. R(low)] ...
1006581	Mycoplasma gallisepticum S6	1 (0.03%)	1E-113	1-287	1-289	415	64	289	ref|YP_008893990.1|	thymidylate synthase [Mycoplasma gallisepticum S6] ref|WP_01...
1276246	Spiroplasma culicicola AES-1	1 (0.03%)	1E-113	1-287	1-289	415	64	289	gb|AHI53100.1|	thymidylate synthase [Spiroplasma culicicola AES-1]
2096	Mycoplasma gallisepticum	1 (0.03%)	1E-112	1-287	1-289	412	64	289	gb|AAD45276.1|AF152114_4	thymidylate synthase [Mycoplasma gallisepticum]
1276220	Spiroplasma taiwanense CT-1	1 (0.03%)	1E-112	1-287	1-289	409	64	289	ref|YP_008311732.1|	thymidylate synthase [Spiroplasma taiwanense CT-1] ref|WP_02...
340016	uncultured virus	1 (0.03%)	9E-8	118-167	10-59	64	64	50	gb|ACE75860.1|	putative thymidylate synthase-like protein [uncultured virus...
1276229	Spiroplasma syrphidicola EA-1	1 (0.03%)	1E-117	1-287	1-289	428	63	289	ref|YP_008026477.1|	thymidylate synthase [Spiroplasma syrphidicola EA-1] ref|WP_...
1276258	Spiroplasma apis B31	1 (0.03%)	1E-115	1-287	1-289	420	63	289	ref|YP_008868869.1|	thymidylate synthase [Spiroplasma apis B31] ref|WP_023789786...
265311	Mesoplasma florum L1	1 (0.03%)	1E-112	1-287	1-288	412	63	288	ref|YP_053662.1|	thymidylate synthase [Mesoplasma florum L1] ref|WP_011183318...
272633	Mycoplasma penetrans HF-2	1 (0.03%)	1E-108	1-287	1-289	399	63	289	ref|NP_758075.1|	thymidylate synthase [Mycoplasma penetrans HF-2] ref|WP_0110...
1276257	Spiroplasma sabaudiense Ar-1343	1 (0.03%)	1E-108	1-287	1-289	398	63	289	gb|AHI53991.1|	thymidylate synthase [Spiroplasma sabaudiense Ar-1343]