old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280 . 290 . 300 . 310 . 320 . 330 . 340 . 350 . 360 . 370 . 380
	MAIRIKSTRVGRFVSESVGLGHPDKICDQIADSILDQCLLQSKTSHVACEVFASKNLILIGGEISTSGYVDVVQTAWRILRNLGYNETDFSFLSCINNQSLEINQAVLKNNEINAGDQGITVGYAVNETKQLMPLGVLLAHSFLKQAEKLTKQFDFLKNDMKSQVVLNYSLNQVECEEVLLSIQHTNAISLTELRKVIENNVILPVLNQYGFQDKKPTCLVNPGGSFVLGGPMADTGLTGRKIIVDTYGPYAHHGGGSFSGKDPSKVDRTGAYFARFIAKHIVSLGWASECEVSISWVFSKPNPQSITVKCFNTNIQYDEVLINRVVNNYFNWSITKIIDKLKLLDFVKYSDYAVYGHFGNDLSPWEQPTELDKLECLIKNFH
tmhmm (0)	-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)	-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (4%)	XXXXXXXXXXXXX---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------X
psipred	----------EEEEE---------HHHHHHHHHHHHHHHHH--HHHHHHEEEEEEEEEEEEEEE-------HHHHHHHHHH-----------EEEEEE--HHHHH--------------EE--------------HHHHHHHHHHHHHHH-----------HHHEEEEEE----EEEEEEE---------HHHHHHHHHHHHHHHH----------EEEEE-----EEE---------------------EE------------------HHHHHHHHHHHHHH-----EEEEEEEE--------EEEEEE-------HHHHHHHHHHHH----HHHHHHH-------HHHHH-----------------HHHHHHHHHHH--

# SignalP-4.0 gram- predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    48	    0.153
  max. Y     3	    0.150
  max. S     2	    0.260
  mean S     1-2    0.244
       D     1-2    0.194    0.570  NO
Name=tmp_signalp_seq	SP='NO' D=0.194 D-cutoff=0.570 Networks=SignalP-noTM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-383	alignment	3imlA_308	1-368	0.9452	TRANSFERASE

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
2961	Amphidinium carterae	1 (0.03%)	2E-6	2-36	3-37	61	51	35	gb|ACF28667.1|	S-adenosyl methionine synthase [Amphidinium carterae] gb|ACJ...
6706	Homarus americanus	1 (0.03%)	1E-34	184-293	1-109	154	48	110	gb|ABL75456.1|	methionine adenosyltransferase [Homarus americanus]
9995	Marmota monax	1 (0.03%)	3E-15	4-55	12-63	89	48	52	gb|ABD96041.1|	S-adenosylmethionine synthetase alpha-like [Marmota monax]
515608	Ureaplasma parvum serovar 1 str. ATCC 27813	1 (0.03%)	1E-121	4-380	6-384	441	47	383	ref|WP_006689252.1|	S-adenosylmethionine synthetase [Ureaplasma parvum] gb|EDT48...
505682	Ureaplasma parvum serovar 3 str. ATCC 27815	1 (0.03%)	1E-121	4-380	6-384	440	47	383	ref|YP_001752496.1|	S-adenosylmethionine synthetase [Ureaplasma parvum serovar 3...
519851	Ureaplasma parvum serovar 6 str. ATCC 27818	1 (0.03%)	1E-120	10-380	4-376	439	47	377	ref|WP_006688757.1|	S-adenosylmethionine synthetase [Ureaplasma parvum] gb|EDU19...
626096	Ureaplasma urealyticum serovar 2 str. ATCC 27814	1 (0.03%)	1E-120	10-375	4-371	437	47	372	ref|WP_004027490.1|	S-adenosylmethionine synthetase [Ureaplasma urealyticum] gb|...
550747	Ureaplasma urealyticum serovar 12 str. ATCC 33696	1 (0.03%)	1E-119	10-375	4-371	436	47	372	ref|WP_004027077.1|	S-adenosylmethionine synthetase [Ureaplasma urealyticum] gb|...
626095	Ureaplasma urealyticum serovar 8 str. ATCC 27618	1 (0.03%)	1E-120	10-375	4-371	436	47	372	ref|YP_002284849.1|	S-adenosylmethionine synthetase [Ureaplasma urealyticum sero...
243272	Mycoplasma arthritidis 158L3-1	1 (0.03%)	1E-121	10-381	2-378	440	46	380	ref|YP_002000054.1|	S-adenosylmethionine synthetase [Mycoplasma arthritidis 158L...
1125700	Treponema medium ATCC 700293	1 (0.03%)	1E-160	8-380	2-388	572	45	389	ref|WP_016522483.1|	S-adenosylmethionine synthase [Treponema medium] gb|EPF29788...
1125702	Treponema vincentii F0403	1 (0.03%)	1E-160	8-380	2-388	570	45	389	ref|WP_006188497.1|	S-adenosylmethionine synthetase [Treponema vincentii] gb|EEV...
632	Yersinia pestis	1 (0.03%)	1E-117	10-273	3-277	429	45	276	ref|WP_002217532.1|	S-adenosylmethionine synthetase, partial [Yersinia pestis]
262719	Mycoplasma hyopneumoniae J	1 (0.03%)	1E-117	15-380	9-377	427	45	372	gb|AAZ44534.2|	S-adenosylmethionine synthetase [Mycoplasma hyopneumoniae J]
663321	Candidatus Regiella insecticola LSR1	1 (0.03%)	1E-165	11-377	4-380	587	44	380	ref|WP_006705469.1|	S-adenosylmethionine synthetase [Candidatus Regiella insecti...
1005090	Buchnera aphidicola str. Ak (Acyrthosiphon kondoi)	1 (0.03%)	1E-161	11-375	4-377	575	44	377	ref|YP_005619578.1|	S-adenosylmethionine synthetase [Buchnera aphidicola str. Ak...
262722	Mycoplasma hyopneumoniae 7448	1 (0.03%)	1E-116	15-380	9-377	426	44	372	gb|AAZ53818.2|	S-adenosylmethionine synthetase [Mycoplasma hyopneumoniae 74...
180	Leptospirillum ferrooxidans	1 (0.03%)	2E-78	165-368	25-229	299	44	208	gb|AAO38426.1|	Lfe216p1 [Leptospirillum ferrooxidans]
49451	Nicotiana attenuata	1 (0.03%)	1E-43	164-290	1-131	184	44	132	gb|ABH07509.1|	S-adenosylmethionine synthetase, partial [Nicotiana attenuat...
1095774	Pantoea ananatis PA13	1 (0.03%)	1E-172	10-378	3-380	610	43	381	ref|YP_003521505.1|	MetK [Pantoea ananatis LMG 20103] ref|YP_005935313.1| S-aden...