| Features and Secondary Structure |
| | 1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280 . 290 . 300 . 310 . 320 . 330 . 340 . 350 . 360 . 370 . 380 |
| | MAIRIKSTRVGRFVSESVGLGHPDKICDQIADSILDQCLLQSKTSHVACEVFASKNLILIGGEISTSGYVDVVQTAWRILRNLGYNETDFSFLSCINNQSLEINQAVLKNNEINAGDQGITVGYAVNETKQLMPLGVLLAHSFLKQAEKLTKQFDFLKNDMKSQVVLNYSLNQVECEEVLLSIQHTNAISLTELRKVIENNVILPVLNQYGFQDKKPTCLVNPGGSFVLGGPMADTGLTGRKIIVDTYGPYAHHGGGSFSGKDPSKVDRTGAYFARFIAKHIVSLGWASECEVSISWVFSKPNPQSITVKCFNTNIQYDEVLINRVVNNYFNWSITKIIDKLKLLDFVKYSDYAVYGHFGNDLSPWEQPTELDKLECLIKNFH |
| tmhmm (0) | ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| low complexity (0%) | ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| coiled-coils (0%) | ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| disordered (4%) | XXXXXXXXXXXXX---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------X |
| psipred | ----------EEEEE---------HHHHHHHHHHHHHHHHH--HHHHHHEEEEEEEEEEEEEEE-------HHHHHHHHHH-----------EEEEEE--HHHHH--------------EE--------------HHHHHHHHHHHHHHH-----------HHHEEEEEE----EEEEEEE---------HHHHHHHHHHHHHHHH----------EEEEE-----EEE---------------------EE------------------HHHHHHHHHHHHHH-----EEEEEEEE--------EEEEEE-------HHHHHHHHHHHH----HHHHHHH-------HHHHH-----------------HHHHHHHHHHH-- |
PSI-BLAST Sequence Hits (Top 20 by Identity) ALL DATA
|
| TaxID |
Species |
Alignments |
PSI-Blast Data (alignment with lowest E value) |
| E value |
Query Span |
Sbjct Span |
Bit Score |
Identity |
HSP Length |
Accession |
Description |
| 2961 | Amphidinium carterae | 1 (0.03%) | 2E-6 | 2-36 | 3-37 | 61 | 51 | 35 | gb|ACF28667.1| | S-adenosyl methionine synthase [Amphidinium carterae] gb|ACJ... |
| 6706 | Homarus americanus | 1 (0.03%) | 1E-34 | 184-293 | 1-109 | 154 | 48 | 110 | gb|ABL75456.1| | methionine adenosyltransferase [Homarus americanus] |
| 9995 | Marmota monax | 1 (0.03%) | 3E-15 | 4-55 | 12-63 | 89 | 48 | 52 | gb|ABD96041.1| | S-adenosylmethionine synthetase alpha-like [Marmota monax] |
| 515608 | Ureaplasma parvum serovar 1 str. ATCC 27813 | 1 (0.03%) | 1E-121 | 4-380 | 6-384 | 441 | 47 | 383 | ref|WP_006689252.1| | S-adenosylmethionine synthetase [Ureaplasma parvum] gb|EDT48... |
| 505682 | Ureaplasma parvum serovar 3 str. ATCC 27815 | 1 (0.03%) | 1E-121 | 4-380 | 6-384 | 440 | 47 | 383 | ref|YP_001752496.1| | S-adenosylmethionine synthetase [Ureaplasma parvum serovar 3... |
| 519851 | Ureaplasma parvum serovar 6 str. ATCC 27818 | 1 (0.03%) | 1E-120 | 10-380 | 4-376 | 439 | 47 | 377 | ref|WP_006688757.1| | S-adenosylmethionine synthetase [Ureaplasma parvum] gb|EDU19... |
| 626096 | Ureaplasma urealyticum serovar 2 str. ATCC 27814 | 1 (0.03%) | 1E-120 | 10-375 | 4-371 | 437 | 47 | 372 | ref|WP_004027490.1| | S-adenosylmethionine synthetase [Ureaplasma urealyticum] gb|... |
| 550747 | Ureaplasma urealyticum serovar 12 str. ATCC 33696 | 1 (0.03%) | 1E-119 | 10-375 | 4-371 | 436 | 47 | 372 | ref|WP_004027077.1| | S-adenosylmethionine synthetase [Ureaplasma urealyticum] gb|... |
| 626095 | Ureaplasma urealyticum serovar 8 str. ATCC 27618 | 1 (0.03%) | 1E-120 | 10-375 | 4-371 | 436 | 47 | 372 | ref|YP_002284849.1| | S-adenosylmethionine synthetase [Ureaplasma urealyticum sero... |
| 243272 | Mycoplasma arthritidis 158L3-1 | 1 (0.03%) | 1E-121 | 10-381 | 2-378 | 440 | 46 | 380 | ref|YP_002000054.1| | S-adenosylmethionine synthetase [Mycoplasma arthritidis 158L... |
| 1125700 | Treponema medium ATCC 700293 | 1 (0.03%) | 1E-160 | 8-380 | 2-388 | 572 | 45 | 389 | ref|WP_016522483.1| | S-adenosylmethionine synthase [Treponema medium] gb|EPF29788... |
| 1125702 | Treponema vincentii F0403 | 1 (0.03%) | 1E-160 | 8-380 | 2-388 | 570 | 45 | 389 | ref|WP_006188497.1| | S-adenosylmethionine synthetase [Treponema vincentii] gb|EEV... |
| 632 | Yersinia pestis | 1 (0.03%) | 1E-117 | 10-273 | 3-277 | 429 | 45 | 276 | ref|WP_002217532.1| | S-adenosylmethionine synthetase, partial [Yersinia pestis] |
| 262719 | Mycoplasma hyopneumoniae J | 1 (0.03%) | 1E-117 | 15-380 | 9-377 | 427 | 45 | 372 | gb|AAZ44534.2| | S-adenosylmethionine synthetase [Mycoplasma hyopneumoniae J] |
| 663321 | Candidatus Regiella insecticola LSR1 | 1 (0.03%) | 1E-165 | 11-377 | 4-380 | 587 | 44 | 380 | ref|WP_006705469.1| | S-adenosylmethionine synthetase [Candidatus Regiella insecti... |
| 1005090 | Buchnera aphidicola str. Ak (Acyrthosiphon kondoi) | 1 (0.03%) | 1E-161 | 11-375 | 4-377 | 575 | 44 | 377 | ref|YP_005619578.1| | S-adenosylmethionine synthetase [Buchnera aphidicola str. Ak... |
| 262722 | Mycoplasma hyopneumoniae 7448 | 1 (0.03%) | 1E-116 | 15-380 | 9-377 | 426 | 44 | 372 | gb|AAZ53818.2| | S-adenosylmethionine synthetase [Mycoplasma hyopneumoniae 74... |
| 180 | Leptospirillum ferrooxidans | 1 (0.03%) | 2E-78 | 165-368 | 25-229 | 299 | 44 | 208 | gb|AAO38426.1| | Lfe216p1 [Leptospirillum ferrooxidans] |
| 49451 | Nicotiana attenuata | 1 (0.03%) | 1E-43 | 164-290 | 1-131 | 184 | 44 | 132 | gb|ABH07509.1| | S-adenosylmethionine synthetase, partial [Nicotiana attenuat... |
| 1095774 | Pantoea ananatis PA13 | 1 (0.03%) | 1E-172 | 10-378 | 3-380 | 610 | 43 | 381 | ref|YP_003521505.1| | MetK [Pantoea ananatis LMG 20103] ref|YP_005935313.1| S-aden... |