old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260
	MEYFDAHCHLNCEPLLSEIEKSIANFKLINLKANVVGTDLDNSKIAVELAKKYPDLLKATIGIHPNDVHLVDFKKTKKQLNELLINNRNFISCIGEYGFDYHYTTEFIELQNKFFEMQFEIAETNKLVHMLHIRDAHEKIYEILTRLKPTQPVIFHCFSQDINIAKKLLSLKDLNIDIFFSIPGIVTFKNAQALHEALKIIPSELLLSETDSPWLTPSPFRGKVNWPEYVVHTVSTVAEIKKIEIAEMKRIIVKNAKKLFWH
tmhmm (0)	----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)	----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (0%)	----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
psipred	-EEEEEEE----HHH---HHHHHHHHHH----EEEEEE-HHHHHHHHHHHHHH----EEEEEE-HHHHHHH--HHHHHHHHHHHHH----EEEEEE----------HHHHHHHHHHHHHHHHHHHH--EEEE----HHHHHHHHHHH-----EEEE----HHHHHHHHHHH-----EEEEE-------HHHHHHHHHHHH--HHHH----HHHH--HHHH------HHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHH--

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    25	    0.124
  max. Y    34	    0.133
  max. S    24	    0.226
  mean S     1-33   0.119
       D     1-33   0.127    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.127 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-262	alignment	1zzmA_201	1-259	0.9119	STRUCTURAL GENOMICS, UNKNOWN FUNCTION

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
1112856	Mycoplasma pneumoniae 309	1 (0.03%)	6E-70	1-261	1-261	270	67	261	ref|YP_005175241.1|	TatD DNase family protein [Mycoplasma pneumoniae 309] ref|YP...
2133	Spiroplasma citri	1 (0.03%)	9E-74	1-260	1-253	283	40	263	emb|CAK98232.1|	probable deoxyribonuclease protein [Spiroplasma citri]
350688	Alkaliphilus oremlandii OhILAs	1 (0.03%)	1E-86	2-260	1-252	325	38	261	ref|YP_001514188.1|	TatD family hydrolase [Alkaliphilus oremlandii OhILAs] ref|W...
293826	Alkaliphilus metalliredigens QYMF	1 (0.03%)	3E-84	2-260	1-252	317	38	261	ref|YP_001318012.1|	TatD family hydrolase [Alkaliphilus metalliredigens QYMF] re...
177439	Desulfotalea psychrophila LSv54	1 (0.03%)	2E-79	1-260	13-268	302	38	263	ref|YP_066515.1|	hypothetical protein DP2779 [Desulfotalea psychrophila LSv54...
1274524	Bacillus sonorensis L12	1 (0.03%)	2E-92	2-260	1-252	345	37	261	ref|WP_006640381.1|	deoxyribonuclease YabD [Bacillus sonorensis] gb|EME72349.1| ...
526992	Bacillus cereus AH1271	1 (0.03%)	5E-91	1-260	1-253	340	37	262	ref|WP_002070143.1|	hydrolase TatD [Bacillus cereus] gb|EEL84227.1| Uncharacteri...
527029	Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1	2 (0.06%)	7E-90	2-260	1-252	336	37	261	ref|WP_000895821.1|	hydrolase TatD [Bacillus thuringiensis] gb|EEM79880.1| Uncha...
673518	Bacillus anthracis str. A16R	1 (0.03%)	8E-90	2-260	1-252	336	37	261	ref|NP_842606.1|	TatD family deoxyribonuclease [Bacillus anthracis str. Ames]...
1053193	Bacillus cereus BAG6O-2	1 (0.03%)	9E-90	2-260	1-252	336	37	261	ref|WP_002107291.1|	hydrolase TatD [Bacillus cereus] gb|EJQ36107.1| TatD family ...
796606	Bacillus methanolicus MGA3	1 (0.03%)	9E-90	2-260	1-252	336	37	261	ref|WP_003347135.1|	hydrolase TatD [Bacillus methanolicus] gb|EIJ84044.1| hydrol...
347495	Bacillus cereus F837/76	1 (0.03%)	1E-89	2-260	1-252	335	37	261	ref|YP_892962.1|	TatD family deoxyribonuclease [Bacillus thuringiensis str. A...
1053218	Bacillus cereus MC118	1 (0.03%)	1E-89	2-260	1-252	335	37	261	ref|WP_002159638.1|	hydrolase TatD [Bacillus cereus] gb|EJR01040.1| TatD family ...
526994	Bacillus cereus AH1273	1 (0.03%)	2E-89	2-260	1-252	335	37	261	ref|WP_000895826.1|	hydrolase TatD [Bacillus cereus] gb|EEL90059.1| Uncharacteri...
1053191	Bacillus cereus BAG5X2-1	1 (0.03%)	2E-89	2-260	1-252	335	37	261	ref|WP_000895837.1|	hydrolase TatD [Bacillus cereus] gb|EJQ42959.1| TatD family ...
1053194	Bacillus cereus BAG6X1-1	1 (0.03%)	2E-89	2-260	1-252	335	37	261	ref|WP_000895824.1|	hydrolase TatD [Bacillus cereus] gb|EJS75744.1| TatD family ...
699184	Bacillus cereus SJ1	1 (0.03%)	2E-89	2-260	1-252	335	37	261	ref|WP_000895838.1|	hydrolase TatD [Bacillus cereus] gb|EFI64197.1| deoxyribonuc...
1053231	Bacillus cereus VD118	1 (0.03%)	2E-89	2-260	1-252	334	37	261	ref|WP_016106813.1|	TatD family hydrolase [Bacillus cereus] gb|EOP62585.1| TatD ...
526971	Bacillus cereus MM3	1 (0.03%)	3E-89	2-260	1-252	334	37	261	ref|WP_000895836.1|	hydrolase TatD [Bacillus cereus] gb|EEK69775.1| Uncharacteri...
1053183	Bacillus cereus BAG3X2-1	1 (0.03%)	3E-89	2-260	1-252	334	37	261	ref|WP_000895832.1|	hydrolase TatD [Bacillus cereus] gb|EJQ18132.1| TatD family ...