| Features and Secondary Structure |
| | 1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 |
| | MEYFDAHCHLNCEPLLSEIEKSIANFKLINLKANVVGTDLDNSKIAVELAKKYPDLLKATIGIHPNDVHLVDFKKTKKQLNELLINNRNFISCIGEYGFDYHYTTEFIELQNKFFEMQFEIAETNKLVHMLHIRDAHEKIYEILTRLKPTQPVIFHCFSQDINIAKKLLSLKDLNIDIFFSIPGIVTFKNAQALHEALKIIPSELLLSETDSPWLTPSPFRGKVNWPEYVVHTVSTVAEIKKIEIAEMKRIIVKNAKKLFWH |
| tmhmm (0) | ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| low complexity (0%) | ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| coiled-coils (0%) | ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| disordered (0%) | ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| psipred | -EEEEEEE----HHH---HHHHHHHHHH----EEEEEE-HHHHHHHHHHHHHH----EEEEEE-HHHHHHH--HHHHHHHHHHHHH----EEEEEE----------HHHHHHHHHHHHHHHHHHHH--EEEE----HHHHHHHHHHH-----EEEE----HHHHHHHHHHH-----EEEEE-------HHHHHHHHHHHH--HHHH----HHHH--HHHH------HHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHH-- |
PSI-BLAST Sequence Hits (Top 20 by Identity) ALL DATA
|
| TaxID |
Species |
Alignments |
PSI-Blast Data (alignment with lowest E value) |
| E value |
Query Span |
Sbjct Span |
Bit Score |
Identity |
HSP Length |
Accession |
Description |
| 1112856 | Mycoplasma pneumoniae 309 | 1 (0.03%) | 6E-70 | 1-261 | 1-261 | 270 | 67 | 261 | ref|YP_005175241.1| | TatD DNase family protein [Mycoplasma pneumoniae 309] ref|YP... |
| 2133 | Spiroplasma citri | 1 (0.03%) | 9E-74 | 1-260 | 1-253 | 283 | 40 | 263 | emb|CAK98232.1| | probable deoxyribonuclease protein [Spiroplasma citri] |
| 350688 | Alkaliphilus oremlandii OhILAs | 1 (0.03%) | 1E-86 | 2-260 | 1-252 | 325 | 38 | 261 | ref|YP_001514188.1| | TatD family hydrolase [Alkaliphilus oremlandii OhILAs] ref|W... |
| 293826 | Alkaliphilus metalliredigens QYMF | 1 (0.03%) | 3E-84 | 2-260 | 1-252 | 317 | 38 | 261 | ref|YP_001318012.1| | TatD family hydrolase [Alkaliphilus metalliredigens QYMF] re... |
| 177439 | Desulfotalea psychrophila LSv54 | 1 (0.03%) | 2E-79 | 1-260 | 13-268 | 302 | 38 | 263 | ref|YP_066515.1| | hypothetical protein DP2779 [Desulfotalea psychrophila LSv54... |
| 1274524 | Bacillus sonorensis L12 | 1 (0.03%) | 2E-92 | 2-260 | 1-252 | 345 | 37 | 261 | ref|WP_006640381.1| | deoxyribonuclease YabD [Bacillus sonorensis] gb|EME72349.1| ... |
| 526992 | Bacillus cereus AH1271 | 1 (0.03%) | 5E-91 | 1-260 | 1-253 | 340 | 37 | 262 | ref|WP_002070143.1| | hydrolase TatD [Bacillus cereus] gb|EEL84227.1| Uncharacteri... |
| 527029 | Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1 | 2 (0.06%) | 7E-90 | 2-260 | 1-252 | 336 | 37 | 261 | ref|WP_000895821.1| | hydrolase TatD [Bacillus thuringiensis] gb|EEM79880.1| Uncha... |
| 673518 | Bacillus anthracis str. A16R | 1 (0.03%) | 8E-90 | 2-260 | 1-252 | 336 | 37 | 261 | ref|NP_842606.1| | TatD family deoxyribonuclease [Bacillus anthracis str. Ames]... |
| 1053193 | Bacillus cereus BAG6O-2 | 1 (0.03%) | 9E-90 | 2-260 | 1-252 | 336 | 37 | 261 | ref|WP_002107291.1| | hydrolase TatD [Bacillus cereus] gb|EJQ36107.1| TatD family ... |
| 796606 | Bacillus methanolicus MGA3 | 1 (0.03%) | 9E-90 | 2-260 | 1-252 | 336 | 37 | 261 | ref|WP_003347135.1| | hydrolase TatD [Bacillus methanolicus] gb|EIJ84044.1| hydrol... |
| 347495 | Bacillus cereus F837/76 | 1 (0.03%) | 1E-89 | 2-260 | 1-252 | 335 | 37 | 261 | ref|YP_892962.1| | TatD family deoxyribonuclease [Bacillus thuringiensis str. A... |
| 1053218 | Bacillus cereus MC118 | 1 (0.03%) | 1E-89 | 2-260 | 1-252 | 335 | 37 | 261 | ref|WP_002159638.1| | hydrolase TatD [Bacillus cereus] gb|EJR01040.1| TatD family ... |
| 526994 | Bacillus cereus AH1273 | 1 (0.03%) | 2E-89 | 2-260 | 1-252 | 335 | 37 | 261 | ref|WP_000895826.1| | hydrolase TatD [Bacillus cereus] gb|EEL90059.1| Uncharacteri... |
| 1053191 | Bacillus cereus BAG5X2-1 | 1 (0.03%) | 2E-89 | 2-260 | 1-252 | 335 | 37 | 261 | ref|WP_000895837.1| | hydrolase TatD [Bacillus cereus] gb|EJQ42959.1| TatD family ... |
| 1053194 | Bacillus cereus BAG6X1-1 | 1 (0.03%) | 2E-89 | 2-260 | 1-252 | 335 | 37 | 261 | ref|WP_000895824.1| | hydrolase TatD [Bacillus cereus] gb|EJS75744.1| TatD family ... |
| 699184 | Bacillus cereus SJ1 | 1 (0.03%) | 2E-89 | 2-260 | 1-252 | 335 | 37 | 261 | ref|WP_000895838.1| | hydrolase TatD [Bacillus cereus] gb|EFI64197.1| deoxyribonuc... |
| 1053231 | Bacillus cereus VD118 | 1 (0.03%) | 2E-89 | 2-260 | 1-252 | 334 | 37 | 261 | ref|WP_016106813.1| | TatD family hydrolase [Bacillus cereus] gb|EOP62585.1| TatD ... |
| 526971 | Bacillus cereus MM3 | 1 (0.03%) | 3E-89 | 2-260 | 1-252 | 334 | 37 | 261 | ref|WP_000895836.1| | hydrolase TatD [Bacillus cereus] gb|EEK69775.1| Uncharacteri... |
| 1053183 | Bacillus cereus BAG3X2-1 | 1 (0.03%) | 3E-89 | 2-260 | 1-252 | 334 | 37 | 261 | ref|WP_000895832.1| | hydrolase TatD [Bacillus cereus] gb|EJQ18132.1| TatD family ... |