old.robetta.org

A new Robetta server is available for structure prediction.

This service will be discontinued at the end of April 2026

     
Fragment Libraries    Alanine Scanning    DNA Interface Scan
[ Queue ] [ Submit ]    [ Queue ] [ Submit ]    [ Queue ] [ Submit ]
[ Register / Update ] [ Docs / FAQs ] [ Login ]


     
Job 88269 [SSGCID - MygeA.00390.a] [2019-01-18] [D-172-16-30-137.dhcp4.x.x] [Structure] [Complete] Uncharacterized protein MG240 (MG_240) - BATCH:88256

Full Structure Predictions  
Model 1

 chemical/x-pdb  MIME type  PDB file
Model 2

 chemical/x-pdb  MIME type  PDB file
Model 3

 chemical/x-pdb  MIME type  PDB file
Model 4

 chemical/x-pdb  MIME type  PDB file
Model 5

 chemical/x-pdb  MIME type  PDB file

Click the icons below each image to download the prediction in PDB format ( PDB file )

Images were produced using MolScript and Raster3D!




Plots powered by Plotly.js.

Features and Secondary Structure  
 
1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  
 
MKQKIIIFGGSFDPIHNAHLYIAKHAIKKIKAQKLFFVPTYNGIFKNNFHASNKDRIAMLKLAIKSVNNALVSNFDIKTKNAFSINTVNHFKSCYPTSEIYFLIGSDKLNELEKWDHIQQLKDLCTFVCYERKPYPFNKKIANQFNVKYLAKCPLEIASSKLLNQPRKKLIPLAVLNYINTNHLYLIPTLKAMVDDKRFQHCLRVGKLAKQLAIANKLDAKRAFVAGAYHDLAKQLPVDQLVNIATSELKITNYPSWKVLHSYVGAYILKNWFGVKDKMIINAIKNHTIPPKQVSKLDMIVYLADKLEPNRKQEQWSGGIEIDQLVKLAKSNLKQAYLITLKYVQNLVKD
tmhmm (0)
--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (4%)
---------------------XXXXXXXXXXXXX----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)
--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (1%)
X------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------X
psipred
---EEEEE--------HHHHHHHHHHHHH----EEEEEE-------------HHHHHHHHHHHHHH--------EEE-----EEEEEHHHHH-------EEEEEEHHHHHH----HHHHHHHHH--EEEE--------HHH-----EEEEE-----------------------------------------------HHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHH----HHHHHHHHHH----HHH------HHHHHHHHHHHHH----HHHHHHHHHH--------HHHHHHEE-----------------HHHHHHHHHHHHHHHHHHHHHHHHHHHHH-
sam
---EEEEEE------HHHHHHHHHHHHHHH---EEEEE--------------HHHHHHHHHHHHH----EEEEEEEEE-----EHHHHHHHHHH----EEEEEE---HHHHHHHH--HHHHHHH-EEEEEE-------HHHHH----EEE--------HHHHHHHHHH----HHHHHHHHHH--HHHHHHHH---HHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHH----HHHHHHHHHHH--HHH------EHHHHHHHHHHHHH----HHHHHHHHH---------HHHHEEEEE-------------HHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHH-
jufo
--EEEEEE------HHHHHHHHHHHHHHHH---EEEEEEE-----------HHHHHHHHHHHHHHHHH--------------HHHHHHHHHHH-----EEEEEE---HHHHHHHHHHHHHHHHHEEEEEEE--------HHHH------HHHH-----HHHHHH----HH---HHH-------------------------HHHHHHHHHHHHHHH---HHHHHHHHHHHHHH----HHHHHHHHHH---------HHHHHHHHHHHHHHHHH----HHHHHHHH----------HHHHHHHEE----------------HHHHHHHHHHHHHHHHHHHHHHHHHHHHH-

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    52	    0.125
  max. Y     2	    0.133
  max. S    32	    0.229
  mean S     1-1    0.177
       D     1-1    0.150    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.150 D-cutoff=0.450 Networks=SignalP-TM


Domain Repeats Prediction     Top
  Boundary     STD (+/-)     Consensus  
------


Ginzu Domain Prediction 1       Top
Domain Span Source Reference Parent   Parent Span     Confidence     Annotations  
  1-187     alignment     4ymiB_203     1-198   0.832100   --
  188-350     alignment     2ogiA_201     1-193   0.923800   HYDROLASE


PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA       Top
TaxID Species Alignments PSI-Blast Data (alignment with lowest E value)
E value Query Span Sbjct Span Bit Score Identity HSP Length Accession Description
662947Mycoplasma genitalium M22881 (0.03%)2E-901-3501-350339100350ref|NP_072906.2|nicotinate-nucleotide adenylyltransferase [Mycoplasma genita...
2097Mycoplasma genitalium1 (0.03%)1E-7527-3503-326290100324ref|WP_009885777.1|nicotinate-nucleotide adenylyltransferase [Mycoplasma genita...
722438Mycoplasma pneumoniae FH1 (0.03%)1E-821-3501-34931358350ref|YP_005881353.1|nicotinate-nucleotide adenylyltransferase [Mycoplasma pneumo...
1238993Mycoplasma pneumoniae M129-B71 (0.03%)4E-821-3501-34931158350ref|NP_110024.2|nicotinate-nucleotide adenylyltransferase [Mycoplasma pneumo...
1112856Mycoplasma pneumoniae 3091 (0.03%)5E-797-3502-34430158344ref|YP_005175575.1|putative nicotinate-nucleotide adenylyl transferase [Mycopla...
272634Mycoplasma pneumoniae M1291 (0.03%)1E-787-3502-34430058344sp|P75442.2|Y336_MYCPNRecName: Full=Uncharacterized protein MG240 homolog gb|AAB96...
1048830Mycoplasma iowae 6951 (0.03%)6E-642-3503-34725137352ref|WP_004024830.1|nicotinate-nucleotide adenylyltransferase [Mycoplasma iowae]...
367737Arcobacter butzleri RM40182 (0.05%)4E-354-1632-15715537161ref|YP_001491015.1|nicotinate (nicotinamide) nucleotide adenylyltransferase [Ar...
562982Gemella morbillorum M4241 (0.03%)6E-365-1433-14415836142ref|WP_004632984.1|nicotinate nucleotide adenylyltransferase [Gemella morbillor...
1159211Streptococcus pneumoniae SPAR551 (0.03%)3E-71-471-45633647ref|YP_003877544.1|phosphopantetheine adenylyltransferase [Streptococcus pneumo...
1159204Mycoplasma gallisepticum NC08_2008.031-4-3P1 (0.03%)2E-713-3492-35727535356ref|YP_006581298.1|nicotinate-nucleotide adenylyltransferase [Mycoplasma gallis...
710128Mycoplasma gallisepticum str. R(high)1 (0.03%)6E-713-3492-35727435356ref|NP_853199.2|putative nicotinate-nucleotide adenylyltransferase [Mycoplas...
1006581Mycoplasma gallisepticum S61 (0.03%)5E-713-3492-35727435356ref|YP_008894335.1|nicotinate-nucleotide adenylyltransferase [Mycoplasma gallis...
708616Mycoplasma gallisepticum str. F1 (0.03%)8E-713-3492-35727335356ref|YP_005880690.1|nicotinate-nucleotide adenylyltransferase [Mycoplasma gallis...
272633Mycoplasma penetrans HF-21 (0.03%)1E-613-3502-34524335351ref|NP_757906.1|nicotinate-nucleotide adenylyltransferase [Mycoplasma penetr...
580327Thermoanaerobacterium thermosaccharolyticum DSM 5711 (0.03%)8E-45181-3491-16618735172ref|YP_003851748.1|metal dependent phosphohydrolase [Thermoanaerobacterium ther...
697303Thermoanaerobacter wiegelii Rt8.B11 (0.03%)9E-44195-35017-16918435159ref|YP_004819721.1|metal dependent phosphohydrolase [Thermoanaerobacter wiegeli...
391592Caminibacter mediatlanticus TB-23 (0.08%)1E-384-1692-16016735167ref|WP_007475097.1|nicotinate-nucleotide adenylyltransferase [Caminibacter medi...
683083Campylobacter jejuni subsp. jejuni 4141 (0.03%)7E-344-1432-14215135141ref|WP_002863733.1|nicotinate-nucleotide adenylyltransferase [Campylobacter jej...
1276258Spiroplasma apis B311 (0.03%)3E-831-3461-34131534348ref|YP_008868830.1|nicotinic acid mononucleotide adenylyltransferase [Spiroplas...






Robetta is available for NON-COMMERCIAL USE ONLY at this time
[ Terms of Service ]
Copyright © 2004-2011 University of Washington