| Features and Secondary Structure |
| | 1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . |
| | MPDSNFGIVLQSLAKQCKVFWNNQIITAFPQKKLQWKNDFKLMVGDRVQLEDGAITKVLARKNELTRPRVANVDQIVLIQSLVQPKINWIQLLKLLVYFNAKLIDEIPILITKTDLDFDPMEKQKLIDLKQFNYQLFFVSKNEPLPSELIDIFSKKLSVFTGQSGVGKSSLINRLDPSLKQKIQALSVNKFGKNTTTKTTLFSFRGGFICDTPGFNVISIKNLKILAAQHFVGFQKMISKCHFSNCYHQYEKDCFVTTSVMKNRYPSWLYEKYRKMIN |
| tmhmm (0) | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| low complexity (2%) | --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXX------------------------------------------------------------------------------ |
| coiled-coils (0%) | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| disordered (2%) | XXX---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------X-XX---------------------------------------------------------------------------------------- |
| psipred | -----EEEEEEEE--EEEEEE--EEEEEEE-----------------EEEE--EEEEEE----EEE--------EEEEEEE-------HHHHHHHHHHHHH-----EEEEEE-----HHHHHHHHHHHHH----EEEEEE----HHHHHHHHH---EEEEE------HHHHHHHHHHHHHHHH----------------EEE-----EEEE-------------HHHHHHHHHHHHHH----------------HHHHHHH-----HHHHHHHHHHH- |
PSI-BLAST Sequence Hits (Top 20 by Identity) ALL DATA
|
| TaxID |
Species |
Alignments |
PSI-Blast Data (alignment with lowest E value) |
| E value |
Query Span |
Sbjct Span |
Bit Score |
Identity |
HSP Length |
Accession |
Description |
| 2097 | Mycoplasma genitalium | 1 (0.03%) | 5E-61 | 1-220 | 1-220 | 241 | 100 | 220 | ref|WP_009885668.1| | ribosome biogenesis GTPase RsgA [Mycoplasma genitalium] |
| 469597 | Coprobacillus sp. 8_2_54BFAA | 4 (0.11%) | 2E-99 | 5-274 | 2-276 | 368 | 35 | 277 | ref|WP_003538448.1| | GTPase A [Erysipelotrichaceae] gb|EDS17776.1| ribosome small... |
| 550773 | Ureaplasma urealyticum serovar 9 str. ATCC 33175 | 1 (0.03%) | 1E-69 | 7-277 | 3-283 | 269 | 35 | 282 | ref|WP_004026834.1| | ribosome biogenesis GTPase RsgA [Ureaplasma urealyticum] gb|... |
| 702456 | Listeria innocua FSL S4-378 | 2 (0.05%) | 5E-81 | 51-277 | 9-238 | 307 | 34 | 232 | gb|EFR90350.1| | ribosome small subunit-dependent GTPase A [Listeria innocua ... |
| 441768 | Acholeplasma laidlawii PG-8A | 3 (0.08%) | 1E-72 | 40-276 | 38-283 | 279 | 34 | 247 | ref|YP_001620254.1| | RNA-binding GTPase [Acholeplasma laidlawii PG-8A] ref|WP_012... |
| 519851 | Ureaplasma parvum serovar 6 str. ATCC 27818 | 1 (0.03%) | 3E-71 | 7-277 | 3-283 | 274 | 34 | 282 | ref|NP_078050.2| | ATP/GTP-binding protein [Ureaplasma parvum serovar 3 str. AT... |
| 626096 | Ureaplasma urealyticum serovar 2 str. ATCC 27814 | 2 (0.05%) | 5E-70 | 7-277 | 3-283 | 271 | 34 | 282 | ref|YP_002284615.1| | ribosome small subunit-dependent GTPase A [Ureaplasma urealy... |
| 262723 | Mycoplasma synoviae 53 | 2 (0.05%) | 1E-65 | 31-277 | 27-269 | 256 | 34 | 248 | ref|YP_278252.2| | ATP/GTP-binding protein [Mycoplasma synoviae 53] ref|WP_0112... |
| 1297581 | Anoxybacillus flavithermus AK1 | 1 (0.03%) | 1E-104 | 1-277 | 1-283 | 383 | 33 | 288 | ref|WP_003394999.1| | GTPase RsgA [Anoxybacillus flavithermus] gb|EMT46947.1| GTPa... |
| 690871 | Anoxybacillus sp. DT3-1 | 1 (0.03%) | 1E-104 | 1-277 | 1-283 | 382 | 33 | 288 | ref|WP_009732846.1| | ribosome-associated GTPase [Anoxybacillus] gb|EMI11799.1| ri... |
| 1131731 | Bacillus azotoformans LMG 9581 | 1 (0.03%) | 1E-103 | 1-278 | 1-284 | 382 | 33 | 289 | ref|WP_003332622.1| | GTPase RsgA [Bacillus azotoformans] gb|EKN63835.1| GTPase Rs... |
| 997296 | Bacillus methanolicus PB1 | 1 (0.03%) | 1E-103 | 1-277 | 1-283 | 381 | 33 | 288 | ref|WP_003350247.1| | GTPase A [Bacillus methanolicus] gb|EIJ81544.1| GTPase RsgA ... |
| 1315967 | Anoxybacillus flavithermus NBRC 109594 | 1 (0.03%) | 1E-103 | 1-277 | 1-283 | 381 | 33 | 288 | ref|WP_006323125.1| | ribosome-associated GTPase [Anoxybacillus flavithermus] dbj|... |
| 654421 | Anoxybacillus sp. SK3-4 | 1 (0.03%) | 1E-103 | 1-277 | 1-283 | 381 | 33 | 288 | ref|WP_021094251.1| | ribosome-associated GTPase [Anoxybacillus sp. SK3-4] gb|EPZ3... |
| 1267580 | Anoxybacillus flavithermus TNO-09.006 | 1 (0.03%) | 1E-103 | 1-277 | 1-283 | 381 | 33 | 288 | ref|WP_004891130.1| | ribosome small subunit-dependent GTPase A [Anoxybacillus fla... |
| 665959 | Bacillus sp. 2_A_57_CT2 | 2 (0.05%) | 1E-101 | 1-277 | 1-283 | 373 | 33 | 288 | ref|WP_009330810.1| | GTPase A [Bacillus sp. 2_A_57_CT2] gb|EFV79460.1| ribosome-a... |
| 665099 | Bacillus oceanisediminis | 1 (0.03%) | 1E-101 | 1-277 | 1-283 | 373 | 33 | 288 | ref|WP_019381737.1| | GTPase A [Bacillus oceanisediminis] |
| 1117379 | Bacillus bataviensis LMG 21833 | 1 (0.03%) | 1E-100 | 1-277 | 1-283 | 372 | 33 | 288 | ref|WP_007087790.1| | GTPase RsgA [Bacillus bataviensis] gb|EKN64108.1| GTPase Rsg... |
| 746691 | Oceanobacillus kimchii | 1 (0.03%) | 6E-99 | 1-277 | 1-283 | 367 | 33 | 288 | ref|WP_017796626.1| | GTPase A [Oceanobacillus kimchii] |
| 221109 | Oceanobacillus iheyensis HTE831 | 1 (0.03%) | 3E-97 | 1-277 | 1-283 | 361 | 33 | 288 | ref|NP_692431.1| | ribosome-associated GTPase [Oceanobacillus iheyensis HTE831]... |