old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 .
	MPDSNFGIVLQSLAKQCKVFWNNQIITAFPQKKLQWKNDFKLMVGDRVQLEDGAITKVLARKNELTRPRVANVDQIVLIQSLVQPKINWIQLLKLLVYFNAKLIDEIPILITKTDLDFDPMEKQKLIDLKQFNYQLFFVSKNEPLPSELIDIFSKKLSVFTGQSGVGKSSLINRLDPSLKQKIQALSVNKFGKNTTTKTTLFSFRGGFICDTPGFNVISIKNLKILAAQHFVGFQKMISKCHFSNCYHQYEKDCFVTTSVMKNRYPSWLYEKYRKMIN
tmhmm (0)	--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (2%)	--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXX------------------------------------------------------------------------------
coiled-coils (0%)	--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (2%)	XXX---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------X-XX----------------------------------------------------------------------------------------
psipred	-----EEEEEEEE--EEEEEE--EEEEEEE-----------------EEEE--EEEEEE----EEE--------EEEEEEE-------HHHHHHHHHHHHH-----EEEEEE-----HHHHHHHHHHHHH----EEEEEE----HHHHHHHHH---EEEEE------HHHHHHHHHHHHHHHH----------------EEE-----EEEE-------------HHHHHHHHHHHHHH----------------HHHHHHH-----HHHHHHHHHHH-

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    29	    0.142
  max. Y    29	    0.159
  max. S    14	    0.221
  mean S     1-28   0.152
       D     1-28   0.156    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.156 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-278	alignment	2yv5A_201	1-293	0.7953	HYDROLASE

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
2097	Mycoplasma genitalium	1 (0.03%)	5E-61	1-220	1-220	241	100	220	ref|WP_009885668.1|	ribosome biogenesis GTPase RsgA [Mycoplasma genitalium]
469597	Coprobacillus sp. 8_2_54BFAA	4 (0.11%)	2E-99	5-274	2-276	368	35	277	ref|WP_003538448.1|	GTPase A [Erysipelotrichaceae] gb|EDS17776.1| ribosome small...
550773	Ureaplasma urealyticum serovar 9 str. ATCC 33175	1 (0.03%)	1E-69	7-277	3-283	269	35	282	ref|WP_004026834.1|	ribosome biogenesis GTPase RsgA [Ureaplasma urealyticum] gb|...
702456	Listeria innocua FSL S4-378	2 (0.05%)	5E-81	51-277	9-238	307	34	232	gb|EFR90350.1|	ribosome small subunit-dependent GTPase A [Listeria innocua ...
441768	Acholeplasma laidlawii PG-8A	3 (0.08%)	1E-72	40-276	38-283	279	34	247	ref|YP_001620254.1|	RNA-binding GTPase [Acholeplasma laidlawii PG-8A] ref|WP_012...
519851	Ureaplasma parvum serovar 6 str. ATCC 27818	1 (0.03%)	3E-71	7-277	3-283	274	34	282	ref|NP_078050.2|	ATP/GTP-binding protein [Ureaplasma parvum serovar 3 str. AT...
626096	Ureaplasma urealyticum serovar 2 str. ATCC 27814	2 (0.05%)	5E-70	7-277	3-283	271	34	282	ref|YP_002284615.1|	ribosome small subunit-dependent GTPase A [Ureaplasma urealy...
262723	Mycoplasma synoviae 53	2 (0.05%)	1E-65	31-277	27-269	256	34	248	ref|YP_278252.2|	ATP/GTP-binding protein [Mycoplasma synoviae 53] ref|WP_0112...
1297581	Anoxybacillus flavithermus AK1	1 (0.03%)	1E-104	1-277	1-283	383	33	288	ref|WP_003394999.1|	GTPase RsgA [Anoxybacillus flavithermus] gb|EMT46947.1| GTPa...
690871	Anoxybacillus sp. DT3-1	1 (0.03%)	1E-104	1-277	1-283	382	33	288	ref|WP_009732846.1|	ribosome-associated GTPase [Anoxybacillus] gb|EMI11799.1| ri...
1131731	Bacillus azotoformans LMG 9581	1 (0.03%)	1E-103	1-278	1-284	382	33	289	ref|WP_003332622.1|	GTPase RsgA [Bacillus azotoformans] gb|EKN63835.1| GTPase Rs...
997296	Bacillus methanolicus PB1	1 (0.03%)	1E-103	1-277	1-283	381	33	288	ref|WP_003350247.1|	GTPase A [Bacillus methanolicus] gb|EIJ81544.1| GTPase RsgA ...
1315967	Anoxybacillus flavithermus NBRC 109594	1 (0.03%)	1E-103	1-277	1-283	381	33	288	ref|WP_006323125.1|	ribosome-associated GTPase [Anoxybacillus flavithermus] dbj|...
654421	Anoxybacillus sp. SK3-4	1 (0.03%)	1E-103	1-277	1-283	381	33	288	ref|WP_021094251.1|	ribosome-associated GTPase [Anoxybacillus sp. SK3-4] gb|EPZ3...
1267580	Anoxybacillus flavithermus TNO-09.006	1 (0.03%)	1E-103	1-277	1-283	381	33	288	ref|WP_004891130.1|	ribosome small subunit-dependent GTPase A [Anoxybacillus fla...
665959	Bacillus sp. 2_A_57_CT2	2 (0.05%)	1E-101	1-277	1-283	373	33	288	ref|WP_009330810.1|	GTPase A [Bacillus sp. 2_A_57_CT2] gb|EFV79460.1| ribosome-a...
665099	Bacillus oceanisediminis	1 (0.03%)	1E-101	1-277	1-283	373	33	288	ref|WP_019381737.1|	GTPase A [Bacillus oceanisediminis]
1117379	Bacillus bataviensis LMG 21833	1 (0.03%)	1E-100	1-277	1-283	372	33	288	ref|WP_007087790.1|	GTPase RsgA [Bacillus bataviensis] gb|EKN64108.1| GTPase Rsg...
746691	Oceanobacillus kimchii	1 (0.03%)	6E-99	1-277	1-283	367	33	288	ref|WP_017796626.1|	GTPase A [Oceanobacillus kimchii]
221109	Oceanobacillus iheyensis HTE831	1 (0.03%)	3E-97	1-277	1-283	361	33	288	ref|NP_692431.1|	ribosome-associated GTPase [Oceanobacillus iheyensis HTE831]...