old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210
	MDEKGILVAISGGSCSGKTTVAEMIYQLLSKKLKVAIICQDNYYKSYKNKPLLKRKTINFDHPDAFDWKLLRSHIEDLLNGSIVNVPLYDYINYTRAKKTAKIGPIDVVILEGLMPWFDEKLSRLSKLKIFIETNGEERLIRRIERDWQRGRNIDSIIKQWREIVAPMYEIFVEKMKRNADLILPWSQRREVSTSVLDVAIEHLFHKTVEKNN
tmhmm (0)	---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)	---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (7%)	XXX-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXXXX
psipred	-----EEEEEE------HHHHHHHHHHH------EEEEE---------HHHHHHH--------HHHHHHHHHHHHHHHHH---EE----------------------EEEEE---------------EEEEEE--HHHHH-------------HHHHHHHHHHHHHHHHHHH----HH---EEE------HHHHHHHHHHHHHHHHH------

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    23	    0.146
  max. Y    39	    0.150
  max. S    32	    0.276
  mean S     1-38   0.158
       D     1-38   0.153    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.153 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
121	0.00	121

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-213	alignment	5b3fA_308	1-306	0.9499	--

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
1238993	Mycoplasma pneumoniae M129-B7	1 (0.03%)	2E-52	2-212	3-213	211	74	211	ref|NP_110250.1|	uridine kinase [Mycoplasma pneumoniae M129] ref|YP_005175803...
714313	Lactobacillus sanfranciscensis TMW 1.1304	1 (0.03%)	3E-57	3-204	5-206	227	43	203	ref|YP_004840994.1|	uridine kinase [Lactobacillus sanfranciscensis TMW 1.1304] r...
525327	Lactobacillus hilgardii ATCC 8290	3 (0.09%)	4E-29	85-206	5-127	134	43	123	ref|WP_004561610.1|	uridine kinase [Lactobacillus hilgardii] gb|EEI23452.1| phos...
997346	Desmospora sp. 8437	1 (0.03%)	9E-59	3-207	31-234	232	42	206	ref|WP_009711212.1|	uridine/cytidine kinase [Desmospora sp. 8437] gb|EGK08908.1|...
880073	Caldithrix abyssi DSM 13497	1 (0.03%)	3E-58	3-210	2-209	230	42	209	ref|WP_006927446.1|	uridine/cytidine kinase [Caldithrix abyssi] gb|EHO40461.1| U...
33018	Sporolactobacillus laevolacticus	1 (0.03%)	4E-57	4-206	5-207	227	42	204	ref|WP_023508537.1|	uridine/cytidine kinase [Sporolactobacillus laevolacticus] g...
1130798	Lactobacillus mucosae LM1	1 (0.03%)	7E-55	2-209	5-212	219	42	209	ref|WP_006499983.1|	uridine/cytidine kinase [Lactobacillus mucosae] gb|EHT16136....
997761	Paenibacillus mucilaginosus K02	1 (0.03%)	4E-53	6-205	2-202	213	42	202	ref|YP_004641521.1|	Udk [Paenibacillus mucilaginosus KNP414] ref|YP_005313318.1|...
1002365	Lactobacillus rhamnosus ATCC 21052	2 (0.06%)	2E-52	3-207	4-207	211	42	206	ref|YP_008203280.1|	Uridine kinase [Lactobacillus rhamnosus LOCK900] ref|WP_0057...
219334	Lactobacillus casei subsp. casei ATCC 393	1 (0.03%)	3E-52	3-207	29-232	210	42	206	dbj|BAN74688.1|	uridine kinase [Lactobacillus casei subsp. casei ATCC 393]
1203259	Lactobacillus rhamnosus LRHMDP3	1 (0.03%)	3E-52	3-207	4-207	210	42	206	ref|WP_005715507.1|	Uridine kinase [Lactobacillus rhamnosus] gb|EKS52824.1| Urid...
568703	Lactobacillus rhamnosus GG	1 (0.03%)	4E-52	3-207	4-207	210	42	206	ref|YP_003171460.1|	uridine kinase [Lactobacillus rhamnosus GG] ref|YP_005866143...
1088720	Lactobacillus rhamnosus ATCC 8530	1 (0.03%)	2E-51	3-207	4-207	208	42	206	ref|YP_005873311.1|	uridine kinase [Lactobacillus rhamnosus ATCC 8530] ref|YP_00...
568704	Lactobacillus rhamnosus Lc 705	1 (0.03%)	1E-38	36-209	2-175	165	42	175	ref|YP_003174388.1|	uridine kinase [Lactobacillus rhamnosus Lc 705] ref|WP_01576...
1221537	Lactobacillus florum 2F	1 (0.03%)	2E-60	1-207	4-210	238	41	208	ref|WP_009166773.1|	uridine/cytidine kinase [Lactobacillus florum] gb|EKK20701.1...
1221538	Lactobacillus florum 8D	1 (0.03%)	4E-60	1-207	4-210	237	41	208	gb|ETO40167.1|	Uridine kinase [Lactobacillus florum 8D]
456163	Thermus sp. RL	1 (0.03%)	1E-58	4-196	6-197	232	41	194	ref|WP_008631917.1|	uridine/cytidine kinase [Thermus sp. RL] gb|EIA39498.1| urid...
869210	Marinithermus hydrothermalis DSM 14884	1 (0.03%)	2E-58	4-206	2-204	231	41	204	ref|YP_004367827.1|	Uridine kinase [Marinithermus hydrothermalis DSM 14884] ref|...
525310	Lactobacillus brevis subsp. gravesensis ATCC 27305	2 (0.06%)	6E-58	3-206	6-209	229	41	205	ref|WP_003554313.1|	uridine/cytidine kinase [Lactobacillus] gb|EEI18699.1| uridi...
857291	Prevotella histicola F0411	1 (0.03%)	1E-57	1-207	1-207	228	41	208	ref|WP_008822221.1|	uridine/cytidine kinase [Prevotella histicola] gb|EHG16973.1...