old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 .
	MQLKKPHFQPNKIANCIVIGGMIALGKTTIANTLANHIQAAKVVCELETNDQLVELLLAKMYERSDELLYSPLFQLYFTLNRFGKYQNNCNTINPTIFDRSIFEDWLFAKHNIIRPAVFSYYNQLWNRLAKELVNKHGVPNLYVILDGDWKLFEKRLFMRNRKVEIDNFTKNQLYFQNLHRVYTGFMEAVCNDFGINYCIIDAKLPIVTIIKMILEKLKLQKLDWKFI
tmhmm (0)	------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)	------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (4%)	XXXXXXXXX---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
psipred	---------------EEEEE------HHHHHHHHHHHH------EE---------HHHHHHHH---HHH--HHHHHHHHHHHHHHHHHHHH----EEEEEHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHH-------EEEEEE--HHHHHHHHHH---HHHH------HHHHHHHHHHHHHHHHHHHH-----EEEEE----HHHHHHHHHHHHHHH-------

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    41	    0.387
  max. Y    41	    0.396
  max. S    40	    0.482
  mean S     1-40   0.362
       D     1-40   0.382    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.382 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-228	alignment	5o31O_201	1-314	0.7215	--

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
662945	Mycoplasma genitalium M6320	2 (0.06%)	8E-52	1-228	1-228	209	100	228	ref|NP_072935.1|	hypothetical protein MG_268 [Mycoplasma genitalium G37] ref|...
662947	Mycoplasma genitalium M2288	1 (0.03%)	8E-52	1-228	1-228	209	100	228	ref|YP_006600297.1|	deoxyguanosine kinase [Mycoplasma genitalium M6282] ref|YP_0...
1238993	Mycoplasma pneumoniae M129-B7	1 (0.03%)	4E-48	5-228	6-229	197	66	224	ref|NP_110074.1|	deoxyguanosine kinase/ deoxyadenosine kinase [Mycoplasma pne...
1048830	Mycoplasma iowae 695	1 (0.03%)	6E-37	1-221	17-237	160	55	221	ref|WP_004025071.1|	deoxyguanosine kinase [Mycoplasma iowae] gb|EGZ31218.1| deox...
626096	Ureaplasma urealyticum serovar 2 str. ATCC 27814	2 (0.06%)	1E-43	1-222	6-227	182	54	222	ref|YP_002284511.1|	deoxyguanosine kinase [Ureaplasma urealyticum serovar 10 str...
519851	Ureaplasma parvum serovar 6 str. ATCC 27818	1 (0.03%)	6E-44	1-221	6-226	183	53	221	ref|NP_077916.1|	deoxyguanosine kinase [Ureaplasma parvum serovar 3 str. ATCC...
171287	Mycoplasma moatsii	1 (0.03%)	9E-40	2-209	4-209	169	42	209	ref|WP_022935490.1|	hypothetical protein [Mycoplasma moatsii]
357809	Clostridium phytofermentans ISDg	1 (0.03%)	2E-44	16-222	2-215	185	31	218	ref|YP_001559429.1|	deoxyadenosine kinase [Clostridium phytofermentans ISDg] ref...
1188236	Mycoplasma arginini 7264	1 (0.03%)	2E-35	16-223	2-217	155	30	220	ref|WP_004414739.1|	Deoxyguanosine kinase [Mycoplasma arginini] gb|ENY70051.1| D...
545697	Clostridium celatum DSM 1785	1 (0.03%)	5E-43	18-222	4-215	180	29	216	ref|WP_005213795.1|	deoxynucleoside kinase [Clostridium celatum] gb|EKY26258.1| ...
1131452	Mycoplasma canis UF31	2 (0.06%)	2E-36	16-218	2-210	158	29	213	ref|WP_004795857.1|	deoxyguanosine kinase [Mycoplasma canis] gb|EIE40062.1| deox...
525327	Lactobacillus hilgardii ATCC 8290	3 (0.1%)	4E-35	16-163	2-146	154	29	153	ref|WP_004561664.1|	deoxyguanosine kinase [Lactobacillus hilgardii] gb|EEI23403....
46867	Clostridium chauvoei	1 (0.03%)	1E-43	16-222	2-215	182	28	218	ref|WP_021875358.1|	Putative Deoxyadenosine kinase [Clostridium chauvoei] emb|CD...
1029718	Candidatus Arthromitus sp. SFB-mouse-Japan	1 (0.03%)	2E-42	16-218	2-211	178	28	214	ref|YP_004770883.1|	deoxyadenosine kinase [Candidatus Arthromitus sp. SFB-mouse-...
1054946	Candidatus Arthromitus sp. SFB-5	1 (0.03%)	3E-42	16-218	2-211	178	28	214	ref|YP_005668055.1|	deoxyadenosine kinase [Candidatus Arthromitus sp. SFB-mouse-...
1131455	Mycoplasma canis UFG4	2 (0.06%)	2E-36	16-218	2-210	158	28	213	ref|WP_004794954.1|	deoxyguanosine kinase [Mycoplasma canis] gb|EIE39847.1| deox...
1131454	Mycoplasma canis UFG1	2 (0.06%)	6E-36	16-218	2-210	157	28	213	ref|WP_004796780.1|	deoxyguanosine kinase [Mycoplasma canis] gb|EIE41634.1| deox...
598745	Giardia intestinalis ATCC 50581	2 (0.06%)	8E-22	16-117	32-126	110	28	102	gb|EES98231.1|	Deoxynucleoside kinase [Giardia intestinalis ATCC 50581]
936154	Streptococcus parauberis KCTC 11537	1 (0.03%)	5E-48	16-219	2-208	197	27	215	ref|YP_004479692.1|	deoxyadenosine kinase protein [Streptococcus parauberis KCTC...
981539	Streptococcus gallolyticus subsp. gallolyticus ATCC 43143	2 (0.06%)	4E-46	16-223	1-210	191	27	218	ref|YP_003429954.1|	deoxynucleoside kinase [Streptococcus gallolyticus UCN34] re...