| Features and Secondary Structure |
| | 1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . |
| | MQLKKPHFQPNKIANCIVIGGMIALGKTTIANTLANHIQAAKVVCELETNDQLVELLLAKMYERSDELLYSPLFQLYFTLNRFGKYQNNCNTINPTIFDRSIFEDWLFAKHNIIRPAVFSYYNQLWNRLAKELVNKHGVPNLYVILDGDWKLFEKRLFMRNRKVEIDNFTKNQLYFQNLHRVYTGFMEAVCNDFGINYCIIDAKLPIVTIIKMILEKLKLQKLDWKFI |
| tmhmm (0) | ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ |
| low complexity (0%) | ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ |
| coiled-coils (0%) | ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ |
| disordered (4%) | XXXXXXXXX--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| psipred | ---------------EEEEE------HHHHHHHHHHHH------EE---------HHHHHHHH---HHH--HHHHHHHHHHHHHHHHHHHH----EEEEEHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHH-------EEEEEE--HHHHHHHHHH---HHHH------HHHHHHHHHHHHHHHHHHHH-----EEEEE----HHHHHHHHHHHHHHH------- |
PSI-BLAST Sequence Hits (Top 20 by Identity) ALL DATA
|
| TaxID |
Species |
Alignments |
PSI-Blast Data (alignment with lowest E value) |
| E value |
Query Span |
Sbjct Span |
Bit Score |
Identity |
HSP Length |
Accession |
Description |
| 662945 | Mycoplasma genitalium M6320 | 2 (0.06%) | 8E-52 | 1-228 | 1-228 | 209 | 100 | 228 | ref|NP_072935.1| | hypothetical protein MG_268 [Mycoplasma genitalium G37] ref|... |
| 662947 | Mycoplasma genitalium M2288 | 1 (0.03%) | 8E-52 | 1-228 | 1-228 | 209 | 100 | 228 | ref|YP_006600297.1| | deoxyguanosine kinase [Mycoplasma genitalium M6282] ref|YP_0... |
| 1238993 | Mycoplasma pneumoniae M129-B7 | 1 (0.03%) | 4E-48 | 5-228 | 6-229 | 197 | 66 | 224 | ref|NP_110074.1| | deoxyguanosine kinase/ deoxyadenosine kinase [Mycoplasma pne... |
| 1048830 | Mycoplasma iowae 695 | 1 (0.03%) | 6E-37 | 1-221 | 17-237 | 160 | 55 | 221 | ref|WP_004025071.1| | deoxyguanosine kinase [Mycoplasma iowae] gb|EGZ31218.1| deox... |
| 626096 | Ureaplasma urealyticum serovar 2 str. ATCC 27814 | 2 (0.06%) | 1E-43 | 1-222 | 6-227 | 182 | 54 | 222 | ref|YP_002284511.1| | deoxyguanosine kinase [Ureaplasma urealyticum serovar 10 str... |
| 519851 | Ureaplasma parvum serovar 6 str. ATCC 27818 | 1 (0.03%) | 6E-44 | 1-221 | 6-226 | 183 | 53 | 221 | ref|NP_077916.1| | deoxyguanosine kinase [Ureaplasma parvum serovar 3 str. ATCC... |
| 171287 | Mycoplasma moatsii | 1 (0.03%) | 9E-40 | 2-209 | 4-209 | 169 | 42 | 209 | ref|WP_022935490.1| | hypothetical protein [Mycoplasma moatsii] |
| 357809 | Clostridium phytofermentans ISDg | 1 (0.03%) | 2E-44 | 16-222 | 2-215 | 185 | 31 | 218 | ref|YP_001559429.1| | deoxyadenosine kinase [Clostridium phytofermentans ISDg] ref... |
| 1188236 | Mycoplasma arginini 7264 | 1 (0.03%) | 2E-35 | 16-223 | 2-217 | 155 | 30 | 220 | ref|WP_004414739.1| | Deoxyguanosine kinase [Mycoplasma arginini] gb|ENY70051.1| D... |
| 545697 | Clostridium celatum DSM 1785 | 1 (0.03%) | 5E-43 | 18-222 | 4-215 | 180 | 29 | 216 | ref|WP_005213795.1| | deoxynucleoside kinase [Clostridium celatum] gb|EKY26258.1| ... |
| 1131452 | Mycoplasma canis UF31 | 2 (0.06%) | 2E-36 | 16-218 | 2-210 | 158 | 29 | 213 | ref|WP_004795857.1| | deoxyguanosine kinase [Mycoplasma canis] gb|EIE40062.1| deox... |
| 525327 | Lactobacillus hilgardii ATCC 8290 | 3 (0.1%) | 4E-35 | 16-163 | 2-146 | 154 | 29 | 153 | ref|WP_004561664.1| | deoxyguanosine kinase [Lactobacillus hilgardii] gb|EEI23403.... |
| 46867 | Clostridium chauvoei | 1 (0.03%) | 1E-43 | 16-222 | 2-215 | 182 | 28 | 218 | ref|WP_021875358.1| | Putative Deoxyadenosine kinase [Clostridium chauvoei] emb|CD... |
| 1029718 | Candidatus Arthromitus sp. SFB-mouse-Japan | 1 (0.03%) | 2E-42 | 16-218 | 2-211 | 178 | 28 | 214 | ref|YP_004770883.1| | deoxyadenosine kinase [Candidatus Arthromitus sp. SFB-mouse-... |
| 1054946 | Candidatus Arthromitus sp. SFB-5 | 1 (0.03%) | 3E-42 | 16-218 | 2-211 | 178 | 28 | 214 | ref|YP_005668055.1| | deoxyadenosine kinase [Candidatus Arthromitus sp. SFB-mouse-... |
| 1131455 | Mycoplasma canis UFG4 | 2 (0.06%) | 2E-36 | 16-218 | 2-210 | 158 | 28 | 213 | ref|WP_004794954.1| | deoxyguanosine kinase [Mycoplasma canis] gb|EIE39847.1| deox... |
| 1131454 | Mycoplasma canis UFG1 | 2 (0.06%) | 6E-36 | 16-218 | 2-210 | 157 | 28 | 213 | ref|WP_004796780.1| | deoxyguanosine kinase [Mycoplasma canis] gb|EIE41634.1| deox... |
| 598745 | Giardia intestinalis ATCC 50581 | 2 (0.06%) | 8E-22 | 16-117 | 32-126 | 110 | 28 | 102 | gb|EES98231.1| | Deoxynucleoside kinase [Giardia intestinalis ATCC 50581] |
| 936154 | Streptococcus parauberis KCTC 11537 | 1 (0.03%) | 5E-48 | 16-219 | 2-208 | 197 | 27 | 215 | ref|YP_004479692.1| | deoxyadenosine kinase protein [Streptococcus parauberis KCTC... |
| 981539 | Streptococcus gallolyticus subsp. gallolyticus ATCC 43143 | 2 (0.06%) | 4E-46 | 16-223 | 1-210 | 191 | 27 | 218 | ref|YP_003429954.1| | deoxynucleoside kinase [Streptococcus gallolyticus UCN34] re... |