old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280 . 290 . 300 . 310
	MFKIVFFGTSTLSKKCLEQLFYDNDFEICAVVTQPDKINHRNNKIVPSDVKSFCLEKNITFFQPKQSISIKADLEKLKADIGICVSFGQYLHQDIIDLFPNKVINLHPSKLPLLRGGAPLHWTIINGFKKSALSVIQLVKKMDAGPIWKQQDFLVNNDWNTGDLSIYVEEHSPSFLIECTKEILNKKGKWFEQIGEPTFGLNIRKEQEHLDLNQIYKSFLNWVKGLAPKPGGWLSFEGKNIKIFKAKYVSKSNYKHQLGEIVNISRKGINIALKSNEIISIEKIQIPGKRVMEVSEIINGKHPFVVGKCFK
tmhmm (0)	-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)	-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (0%)	-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
psipred	-EEEEEEE--HHHHHHHHHHHH-----EEEEEE---------------HHHHHHHHH----------HHHHHHHHH----EEEEE-------HHHHH-----EEEE------------HHHHHHH----EEEEEEEEEE-------EEEEEEEEE-----HHHHHHHHHHHHHHHHHHHHHHHH----------HHH-------HHH----HHHHHHHHHHEEEEE-----EEEEE--EEEEEEEEEE-----------EEEEE---EEEEEE----EEEEEEEE-----EEEHHHHH-------------

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    23	    0.109
  max. Y     1	    0.215
  max. S     3	    0.486
  mean S     1-0    0.000
       D     1-0    0.131    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.131 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-311	alignment	5uaiA_201	1-310	0.9384	--

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
470146	Coprococcus comes ATCC 27758	2 (0.05%)	1E-52	3-129	2-129	213	40	129	ref|WP_008370812.1|	methionyl-tRNA formyltransferase [Coprococcus comes] gb|EEG8...
45972	Staphylococcus pasteuri	1 (0.03%)	1E-116	1-310	1-309	425	35	313	ref|YP_008760751.1|	methionyl-tRNA formyltransferase [Staphylococcus pasteuri SP...
1234593	Staphylococcus sp. E463	1 (0.03%)	1E-117	1-310	1-309	429	34	313	ref|WP_017637140.1|	methionyl-tRNA formyltransferase [Staphylococcus sp. E463]
596319	Staphylococcus warneri L37603	1 (0.03%)	1E-116	1-310	1-309	426	34	313	ref|WP_002450593.1|	methionyl-tRNA formyltransferase [Staphylococcus warneri] gb...
1194526	Staphylococcus warneri SG1	1 (0.03%)	1E-116	1-310	1-309	423	34	313	ref|YP_007385268.1|	methionyl-tRNA formyltransferase [Staphylococcus warneri SG1...
1292	Staphylococcus warneri	1 (0.03%)	1E-115	1-310	1-309	420	34	313	ref|WP_019235876.1|	methionyl-tRNA formyltransferase [Staphylococcus warneri]
428126	Clostridium spiroforme DSM 1552	2 (0.05%)	1E-111	3-310	5-316	406	34	314	ref|WP_004610367.1|	methionyl-tRNA formyltransferase [[Clostridium] spiroforme] ...
209882	Fusobacterium nucleatum subsp. vincentii ATCC 49256	3 (0.08%)	8E-49	1-141	1-144	200	34	146	ref|WP_005888388.1|	methionyl-tRNA formyltransferase [Fusobacterium nucleatum] g...
941639	Bacillus coagulans 2-6	1 (0.03%)	1E-120	1-310	1-312	437	33	314	ref|YP_004568526.1|	methionyl-tRNA formyltransferase [Bacillus coagulans 2-6] re...
1398	Bacillus coagulans	3 (0.08%)	1E-120	1-310	1-312	436	33	314	ref|WP_017552945.1|	methionyl-tRNA formyltransferase [Bacillus coagulans]
1121084	Bacillus acidiproducens	1 (0.03%)	1E-119	1-310	1-312	434	33	314	ref|WP_018660010.1|	methionyl-tRNA formyltransferase [Bacillus acidiproducens]
29380	Staphylococcus caprae	1 (0.03%)	1E-118	1-310	1-309	431	33	313	ref|WP_002442483.1|	methionyl-tRNA formyltransferase [Staphylococcus caprae] gb|...
1218173	Bacillus alcalophilus ATCC 27647	1 (0.03%)	1E-116	3-310	2-307	425	33	311	ref|WP_003320796.1|	methionyl-tRNA formyltransferase [Bacillus alcalophilus] gb|...
904334	Staphylococcus capitis VCU116	1 (0.03%)	1E-112	1-310	1-309	413	33	313	ref|WP_002435167.1|	methionyl-tRNA formyltransferase [Staphylococcus capitis] gb...
1229783	Staphylococcus massiliensis S46	1 (0.03%)	1E-113	1-310	1-309	413	33	313	ref|WP_009381655.1|	methionyl-tRNA formyltransferase [Staphylococcus massiliensi...
1296619	Staphylococcus capitis CR01	1 (0.03%)	1E-112	1-310	1-309	411	33	313	ref|WP_023350421.1|	methionyl-tRNA formyltransferase [Staphylococcus capitis] em...
29388	Staphylococcus capitis	1 (0.03%)	1E-112	1-310	3-311	410	33	313	ref|WP_016898744.1|	methionyl-tRNA formyltransferase [Staphylococcus capitis]
435838	Staphylococcus caprae C87	1 (0.03%)	1E-112	1-310	1-309	410	33	313	ref|WP_002453047.1|	methionyl-tRNA formyltransferase [Staphylococcus caprae] gb|...
279808	Staphylococcus haemolyticus JCSC1435	1 (0.03%)	1E-109	1-311	3-312	401	33	314	ref|YP_253614.1|	methionyl-tRNA formyltransferase [Staphylococcus haemolyticu...
519851	Ureaplasma parvum serovar 6 str. ATCC 27818	1 (0.03%)	7E-73	1-304	1-303	280	33	306	ref|WP_006688740.1|	methionyl-tRNA formyltransferase [Ureaplasma parvum] gb|EDT4...