old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 .
	MLIAIWAMTQEGLIGNNNTLPWMIKQELAHFKKTTLFQALLMGRKTYESLPKVFEKRTIFLLSKDQNYRFEEKGSEVKVINDFWPLIKSYQANKEKDLFICGGKSVYEQTINECDQLIVSIIKKKYKGDQFLKVDLSKFVLNEVVEFEEFNVNYYRKKQQ
tmhmm (0)	----------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (9%)	------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXXXXXXXX-------
coiled-coils (0%)	----------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (4%)	--------------------------------------------------------------------------------------------------------------------------------------------------------XX-XXXXX
psipred	-EEEEEEE-----EE---------HHHHHHHHHHH----EEEE--EEE---------EEEEEE------------EEEE---HHHHHHHHHH----EEEEE-HHHHHHHHHHH--EEEEEEE-------------HHH-EEEEEEE------EEEEE---

# SignalP-4.0 euk predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    16	    0.144
  max. Y    16	    0.176
  max. S    11	    0.295
  mean S     1-15   0.217
       D     1-15   0.198    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.198 D-cutoff=0.450 Networks=SignalP-noTM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-160	alignment	3tq8A_101	1-171	0.9177	OXIDOREDUCTASE/OXIDOREDUCTASE INHIBITOR

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
526347	Ureaplasma urealyticum serovar 11 str. ATCC 33695	1 (0.03%)	6E-14	1-50	1-50	83	50	50	gb|AAK58663.1|AF272618_1	dihydrofolate reductase [Ureaplasma urealyticum serovar 2 st...
747682	Mycoplasma alligatoris A21JP2	1 (0.03%)	1E-35	1-157	1-153	154	45	159	ref|WP_005683778.1|	dihydrofolate reductase [Mycoplasma alligatoris] gb|EFF41164...
515609	Ureaplasma parvum serovar 14 str. ATCC 33697	1 (0.03%)	3E-18	1-66	1-67	97	45	67	gb|AAK58673.1|AF272628_1	dihydrofolate reductase [Ureaplasma parvum serovar 1 str. AT...
1129368	Spiroplasma melliferum IPMB4A	1 (0.03%)	1E-50	1-160	1-159	204	41	161	ref|WP_004029130.1|	dihydrofolate reductase [Spiroplasma melliferum] gb|ELL44273...
570509	Spiroplasma melliferum KC3	1 (0.03%)	7E-50	1-160	1-159	202	41	161	ref|WP_004028614.1|	dihydrofolate reductase [Spiroplasma melliferum] gb|EHK52058...
2133	Spiroplasma citri	1 (0.03%)	5E-48	1-160	1-159	195	40	161	emb|CAK98756.1|	putative dihydrofolate reductase oxidoreductase protein [Spi...
1161427	Streptococcus agalactiae BV3L5	1 (0.03%)	5E-44	2-153	5-153	182	38	154	ref|NP_688312.1|	dihydrofolate reductase [Streptococcus agalactiae 2603V/R] r...
888745	Streptococcus agalactiae ATCC 13813	1 (0.03%)	1E-43	2-153	29-177	181	38	154	ref|WP_001872197.1|	dihydrofolate reductase [Streptococcus agalactiae] gb|EFV976...
515608	Ureaplasma parvum serovar 1 str. ATCC 27813	1 (0.03%)	4E-33	1-160	1-155	146	37	161	ref|WP_006689329.1|	dihydrofolate reductase [Ureaplasma parvum] gb|EDT49243.1| d...
626096	Ureaplasma urealyticum serovar 2 str. ATCC 27814	1 (0.03%)	2E-32	1-159	1-154	143	37	160	ref|WP_004025610.1|	dihydrofolate reductase [Ureaplasma urealyticum] gb|EDU06492...
519851	Ureaplasma parvum serovar 6 str. ATCC 27818	1 (0.03%)	2E-32	1-160	1-155	143	37	161	ref|WP_006688837.1|	dihydrofolate reductase [Ureaplasma parvum] gb|EDU18929.1| d...
565653	Enterococcus gallinarum EG2	1 (0.03%)	4E-45	1-160	1-157	186	36	162	gb|EEV32652.1|	dihydrofolate reductase [Enterococcus gallinarum EG2]
742813	Enterococcus saccharolyticus 30_1	1 (0.03%)	5E-45	1-160	1-157	185	36	162	ref|WP_005472261.1|	dihydrofolate reductase [Enterococcus saccharolyticus] gb|EH...
1318	Streptococcus parasanguinis	2 (0.06%)	2E-41	2-145	5-146	174	36	147	emb|CAT00528.1|	dihydrofolate reductase [Streptococcus parasanguinis]
550748	Ureaplasma urealyticum serovar 4 str. ATCC 27816	1 (0.03%)	2E-32	1-159	1-154	144	36	160	ref|WP_004026355.1|	dihydrofolate reductase [Ureaplasma urealyticum] gb|EDT49686...
565575	Ureaplasma urealyticum serovar 10 str. ATCC 33699	1 (0.03%)	3E-31	1-159	1-154	140	36	160	ref|YP_002284536.1|	dihydrofolate reductase [Ureaplasma urealyticum serovar 10 s...
563038	Streptococcus sp. M334	1 (0.03%)	6E-46	2-160	5-167	189	35	168	ref|WP_000162450.1|	dihydrofolate reductase [Streptococcus sp. M334] gb|EFX58282...
585204	Streptococcus mitis SK597	1 (0.03%)	5E-46	2-160	5-167	189	35	168	ref|WP_000162462.1|	dihydrofolate reductase [Streptococcus mitis] gb|EFO01086.1|...
1008452	Streptococcus mitis SK1073	1 (0.03%)	4E-46	2-160	5-167	189	35	168	ref|WP_000162456.1|	dihydrofolate reductase [Streptococcus mitis] gb|EGP69461.1|...
585202	Streptococcus mitis SK321	1 (0.03%)	1E-45	2-160	5-167	188	35	168	ref|WP_000162457.1|	dihydrofolate reductase [Streptococcus mitis] gb|EFN97577.1|...