old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280 . 290 . 300 . 310 . 320 . 330 . 340 . 350 . 360 . 370 . 380 . 390 . 400 .
	MSAIKFNPSSFRKNFKWFENNKNWINFDNAATSIALDVVAEASKEYYQYFCVNPHNKNPEINQKLIAIIEETRDLLAKFFNAKKNEIIFTSSATESLNLFAFGLSSLVKSNDEIILKEDEHAANVFPWVNLAKENKAKLKIIKKTPNKSWTDAFLKACTPSTKLLVITATSNLFGNSIDYEKISKHLKKISPNSFIVVDAVQAVPHHKIDITSANIDFLTFSTHKFYGPTGLGIAFIKSELQSRLKPFKLGGDIFKSLDNNFKIIFKEGPSKFEAGTLNIMAIYALNKQLKFMQKEFNFSEMVFYSKQLKNLAYQLLSQNPNIVLANHDQDVPIFAFKHKYINSADLATFLNIKKIIVRQGSICVGKFKNKESFLRVSLLHYNTKEELLYLEKLLKTSKNSIINELIY
tmhmm (0)	------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (10%)	------------XXXXXXXXXXXXXXX------------------------------------------------------------------------------------------------------XXXXXXXXXXXXXXX------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXXXXX------------
coiled-coils (0%)	------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (1%)	XXXXX-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
psipred	-------HHHHHHH----------EEEE--------HHHHHHHHHHHHH------HHH-HHHHHHHHHHHHHHHHHHHH-------EEE---HHHHHHHHHHHHHHH-----EEEE-----HHHHHHHHHHHH---EEEEEE--------HHHHHHH-----EEEEEE-----------HHHHHHHHHHH----EEEEE------------------EEEEE-HHH-----EEEEEEE--HHH----------EEE-EE------------------HHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHH----EEE--------EEEEEE----HHHHHHHHHH--EEEE-HHHH--------EEEEEEE-----HHHHHHHHHHHHHHHHHHHHHH--

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    43	    0.147
  max. Y     3	    0.207
  max. S     1	    0.422
  mean S     1-2    0.418
       D     1-2    0.289    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.289 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-408	alignment	4q76A_201	1-413	0.9420	--

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
655811	Anaerococcus vaginalis ATCC 51170	1 (0.03%)	1E-131	7-400	2-402	474	35	405	ref|WP_004839287.1|	cysteine desulfurase [Anaerococcus vaginalis] gb|EEU12319.1|...
519851	Ureaplasma parvum serovar 6 str. ATCC 27818	1 (0.03%)	2E-95	9-400	2-394	356	35	395	ref|WP_006688531.1|	cysteine desulfurase [Ureaplasma parvum] gb|EDU19193.1| amin...
515608	Ureaplasma parvum serovar 1 str. ATCC 27813	1 (0.03%)	4E-95	9-400	2-394	355	35	395	ref|WP_006689238.1|	cysteine desulfurase [Ureaplasma parvum] gb|EDT48957.1| amin...
37692	Candidatus Phytoplasma mali	1 (0.03%)	9E-92	9-404	4-397	344	35	400	ref|YP_002004153.1|	selenocysteine lyase [Candidatus Phytoplasma mali] ref|WP_01...
879306	Anaerococcus hydrogenalis ACS-025-V-Sch4	1 (0.03%)	1E-131	7-400	2-402	476	34	405	ref|WP_004818610.1|	cysteine desulfurase [Anaerococcus hydrogenalis] gb|EGC83129...
561177	Anaerococcus hydrogenalis DSM 7454	1 (0.03%)	1E-131	7-400	2-402	475	34	405	ref|WP_004814936.1|	cysteine desulfurase [Anaerococcus hydrogenalis] gb|EEB35604...
444179	Candidatus Sulcia muelleri GWSS	2 (0.05%)	1E-121	5-389	4-393	441	34	394	ref|YP_001597993.1|	cysteine desulphurase, SufS [Candidatus Sulcia muelleri GWSS...
641892	Candidatus Sulcia muelleri DMIN	1 (0.03%)	1E-121	5-389	4-393	440	34	394	ref|YP_003543338.1|	cysteine desulfurase [Candidatus Sulcia muelleri DMIN] ref|W...
706194	Candidatus Sulcia muelleri CARI	1 (0.03%)	1E-116	5-391	4-395	426	34	396	ref|YP_003880711.1|	cysteine desulfurase SufS [Candidatus Sulcia muelleri CARI] ...
59748	Candidatus Phytoplasma australiense	1 (0.03%)	1E-103	9-404	9-402	382	34	400	ref|YP_001799130.1|	Selenocysteine lyase [Candidatus Phytoplasma australiense] r...
626096	Ureaplasma urealyticum serovar 2 str. ATCC 27814	1 (0.03%)	7E-99	9-400	2-394	367	34	395	ref|YP_002284881.1|	probable cysteine desulfurase [Ureaplasma urealyticum serova...
626095	Ureaplasma urealyticum serovar 8 str. ATCC 27618	1 (0.03%)	2E-98	9-400	2-394	366	34	395	ref|WP_004025870.1|	cysteine desulfurase [Ureaplasma urealyticum] gb|EDU06269.1|...
391587	Kordia algicida OT-1	2 (0.05%)	5E-83	6-235	8-240	315	34	235	ref|WP_007096276.1|	cysteine desulfurase [Kordia algicida] gb|EDP97225.1| cystei...
28189	Capnocytophaga cynodegmi	1 (0.03%)	1E-141	8-402	4-405	506	33	406	ref|WP_018279296.1|	cysteine desulfurase [Capnocytophaga cynodegmi]
860228	Capnocytophaga canimorsus Cc5	1 (0.03%)	1E-139	8-402	4-405	501	33	406	ref|YP_004741184.1|	putative cysteine desulfurase [Capnocytophaga canimorsus Cc5...
595499	Candidatus Sulcia muelleri SMDSEM	1 (0.03%)	1E-118	8-402	7-406	430	33	404	ref|YP_003108578.1|	cysteine desulphurase, SufS [Candidatus Sulcia muelleri SMDS...
498742	Borrelia spielmanii A14S	1 (0.03%)	1E-108	8-402	13-421	399	33	412	ref|WP_006434102.1|	cysteine desulfurase [Borrelia spielmanii] gb|EEF84179.1| am...
445987	Borrelia valaisiana VS116	1 (0.03%)	1E-107	8-402	13-421	395	33	412	ref|WP_006068568.1|	cysteine desulfurase [Borrelia valaisiana] gb|EEF81760.1| am...
498738	Borrelia burgdorferi 29805	1 (0.03%)	1E-107	8-402	13-421	394	33	412	ref|WP_002663723.1|	cysteine desulfurase [Borrelia burgdorferi] gb|EEH32663.1| a...
498741	Borrelia sp. SV1	1 (0.03%)	1E-106	8-402	13-421	393	33	412	ref|WP_008882802.1|	cysteine desulfurase [Borrelia sp. SV1] gb|EEH00874.1| amino...