| Features and Secondary Structure |
| | 1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 |
| | MENKPILSFEKVSIIYKKAPLLQNISFKVMAKENVCLLGKSGVGKSSLLNSVTNTKIVKSGLVYFDGVASNKKEYKKLKKQCSYLDQIPNLIDTDYVYEAILRSAKQKLTWLQKLICFEPKWIKDKILAILKEVNLNDYVSCIIKDLSAGQKQRVEIAKLFFKSPKLLLVDEPTTGLDPLTASKIMDLITDFVKREKITLVFVTHDIDLALKYSTRIIALKNHALVLDRLTEKLTKEQLYKIYDN |
| tmhmm (0) | ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| low complexity (0%) | ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| coiled-coils (0%) | ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| disordered (2%) | XXX-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------X |
| psipred | -----EEEEEEEEEEE---EEE--EEEEE----EEEEE------HHHHHHHHH--------EEEE--EE-----HHHHHHH--EEE----------HHHHHHH------HHHHHH----HHHHHHHHHHHHHH---HHHH----HH--HHHHHHHHHHHHHH----EEEE--------HHHHHHHHHHHHHHHHHH--EEEEE---HHHHHHH--EEEEEE--EEEEE--HHHHHHHHHHHHH-- |
PSI-BLAST Sequence Hits (Top 20 by Identity) ALL DATA
|
| TaxID |
Species |
Alignments |
PSI-Blast Data (alignment with lowest E value) |
| E value |
Query Span |
Sbjct Span |
Bit Score |
Identity |
HSP Length |
Accession |
Description |
| 411465 | Parvimonas micra ATCC 33270 | 1 (0.03%) | 3E-72 | 1-243 | 1-246 | 277 | 32 | 247 | ref|WP_004833162.1| | phosphonate ABC transporter ATP-binding protein [Parvimonas ... |
| 403833 | Petrotoga mobilis SJ95 | 1 (0.03%) | 5E-76 | 2-238 | 4-233 | 290 | 30 | 238 | ref|YP_001568673.1| | ABC transporter-like protein [Petrotoga mobilis SJ95] ref|WP... |
| 762966 | Parasutterella excrementihominis YIT 11859 | 2 (0.05%) | 6E-84 | 2-235 | 7-234 | 316 | 29 | 236 | ref|WP_008810699.1| | peptide ABC transporter ATP-binding protein [Burkholderiales... |
| 1202533 | Bacillus nealsonii AAU1 | 4 (0.1%) | 2E-83 | 7-242 | 4-241 | 314 | 29 | 246 | ref|WP_016202695.1| | glutamine ABC transporter ATP-binding protein [Bacillus neal... |
| 314608 | Shewanella benthica KT99 | 1 (0.03%) | 3E-82 | 6-235 | 1-224 | 311 | 29 | 232 | ref|WP_005501268.1| | peptide ABC transporter ATP-binding protein [Shewanella bent... |
| 866775 | Aerococcus urinae ACS-120-V-Col10a | 2 (0.05%) | 5E-82 | 6-241 | 2-232 | 310 | 29 | 238 | ref|YP_004321747.1| | glutamine ABC transporter ATP-binding protein GlnQ [Aerococc... |
| 420247 | Methanobrevibacter smithii ATCC 35061 | 1 (0.03%) | 3E-73 | 6-244 | 3-227 | 281 | 29 | 246 | ref|YP_001273378.1| | polar amino acid ABC transporter, ATPase component [Methanob... |
| 1151391 | Clostridium difficile Y384 | 1 (0.03%) | 4E-72 | 4-240 | 3-229 | 277 | 29 | 237 | ref|YP_005353875.1| | Spermidine/putrescine import ATP-binding protein PotA [Enter... |
| 457421 | Clostridiales bacterium 1_7_47FAA | 3 (0.07%) | 3E-86 | 1-235 | 1-227 | 324 | 28 | 237 | ref|WP_008716170.1| | peptide ABC transporter ATP-binding protein [Clostridiales b... |
| 997296 | Bacillus methanolicus PB1 | 2 (0.05%) | 3E-85 | 6-243 | 1-235 | 321 | 28 | 243 | ref|WP_003350565.1| | amino acid ABC transporter ATPase [Bacillus methanolicus] gb... |
| 1246477 | Brevibacillus agri BAB-2500 | 4 (0.1%) | 1E-84 | 6-241 | 1-230 | 319 | 28 | 238 | ref|WP_005835001.1| | amino acid ABC transporter ATPase [Brevibacillus] gb|EJL4428... |
| 1008452 | Streptococcus mitis SK1073 | 1 (0.03%) | 1E-83 | 1-237 | 1-230 | 315 | 28 | 239 | ref|WP_000140956.1| | peptide ABC transporter ATP-binding protein [Streptococcus m... |
| 1144308 | Brevibacillus sp. BC25 | 6 (0.15%) | 2E-83 | 6-241 | 1-230 | 315 | 28 | 238 | ref|WP_007715956.1| | amino acid ABC transporter ATPase [Brevibacillus sp. BC25] g... |
| 760835 | Streptococcus pneumoniae GA47373 | 1 (0.03%) | 2E-83 | 6-237 | 1-226 | 314 | 28 | 234 | ref|WP_001836109.1| | peptide ABC transporter ATP-binding protein [Streptococcus p... |
| 1239786 | Streptococcus pneumoniae 801 | 1 (0.03%) | 2E-83 | 1-237 | 1-230 | 314 | 28 | 239 | ref|WP_000140961.1| | peptide ABC transporter ATP-binding protein [Streptococcus p... |
| 1078085 | Paenisporosarcina sp. HGH0030 | 2 (0.05%) | 2E-83 | 6-242 | 1-239 | 314 | 28 | 247 | ref|WP_016428586.1| | hypothetical protein [Paenisporosarcina sp. HGH0030] gb|EPD5... |
| 1035187 | Streptococcus mitis SK569 | 1 (0.03%) | 2E-83 | 1-237 | 1-230 | 314 | 28 | 239 | ref|WP_000169047.1| | peptide ABC transporter ATP-binding protein [Streptococcus m... |
| 760788 | Streptococcus pneumoniae GA17484 | 1 (0.03%) | 3E-83 | 1-237 | 1-230 | 314 | 28 | 239 | ref|WP_000140965.1| | peptide ABC transporter ATP-binding protein [Streptococcus p... |
| 1393 | Brevibacillus brevis | 6 (0.15%) | 3E-83 | 6-241 | 1-230 | 314 | 28 | 238 | ref|WP_017247419.1| | amino acid ABC transporter ATPase [Brevibacillus brevis] |
| 1239789 | Streptococcus pneumoniae 1488 | 1 (0.03%) | 4E-83 | 1-237 | 1-230 | 314 | 28 | 239 | ref|WP_000140967.1| | peptide ABC transporter ATP-binding protein [Streptococcus p... |