old.robetta.org

A new Robetta server is available for structure prediction.

This service will be discontinued at the end of April 2026

     
Fragment Libraries    Alanine Scanning    DNA Interface Scan
[ Queue ] [ Submit ]    [ Queue ] [ Submit ]    [ Queue ] [ Submit ]
[ Register / Update ] [ Docs / FAQs ] [ Login ]


     
Job 88282 [SSGCID - MygeA.01280.a] [2019-01-18] [D-172-16-30-137.dhcp4.x.x] [Structure] [Complete] Probable ABC transporter ATP-binding protein p29 (MG_290) - BATCH:88256

Full Structure Predictions  
Model 1

 chemical/x-pdb  MIME type  PDB file
Model 2

 chemical/x-pdb  MIME type  PDB file
Model 3

 chemical/x-pdb  MIME type  PDB file
Model 4

 chemical/x-pdb  MIME type  PDB file
Model 5

 chemical/x-pdb  MIME type  PDB file

Click the icons below each image to download the prediction in PDB format ( PDB file )

Images were produced using MolScript and Raster3D!




Plots powered by Plotly.js.

Features and Secondary Structure  
 
1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240  
 
MENKPILSFEKVSIIYKKAPLLQNISFKVMAKENVCLLGKSGVGKSSLLNSVTNTKIVKSGLVYFDGVASNKKEYKKLKKQCSYLDQIPNLIDTDYVYEAILRSAKQKLTWLQKLICFEPKWIKDKILAILKEVNLNDYVSCIIKDLSAGQKQRVEIAKLFFKSPKLLLVDEPTTGLDPLTASKIMDLITDFVKREKITLVFVTHDIDLALKYSTRIIALKNHALVLDRLTEKLTKEQLYKIYDN
tmhmm (0)
-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)
-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)
-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (2%)
XXX-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------X
psipred
-----EEEEEEEEEEE---EEE--EEEEE----EEEEE------HHHHHHHHH--------EEEE--EE-----HHHHHHH--EEE----------HHHHHHH------HHHHHH----HHHHHHHHHHHHHH---HHHH----HH--HHHHHHHHHHHHHH----EEEE--------HHHHHHHHHHHHHHHHHH--EEEEE---HHHHHHH--EEEEEE--EEEEE--HHHHHHHHHHHHH--

# SignalP-4.0 gram- predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    32	    0.447
  max. Y    32	    0.249
  max. S    31	    0.193
  mean S     1-31   0.136
       D     1-31   0.196    0.570  NO
Name=tmp_signalp_seq	SP='NO' D=0.196 D-cutoff=0.570 Networks=SignalP-noTM


Domain Repeats Prediction     Top
  Boundary     STD (+/-)     Consensus  
------


Ginzu Domain Prediction 1       Top
Domain Span Source Reference Parent   Parent Span     Confidence     Annotations  
  1-245     alignment     4wbsB_202     1-257   0.8694   --


PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA       Top
TaxID Species Alignments PSI-Blast Data (alignment with lowest E value)
E value Query Span Sbjct Span Bit Score Identity HSP Length Accession Description
411465Parvimonas micra ATCC 332701 (0.03%)3E-721-2431-24627732247ref|WP_004833162.1|phosphonate ABC transporter ATP-binding protein [Parvimonas ...
403833Petrotoga mobilis SJ951 (0.03%)5E-762-2384-23329030238ref|YP_001568673.1|ABC transporter-like protein [Petrotoga mobilis SJ95] ref|WP...
762966Parasutterella excrementihominis YIT 118592 (0.05%)6E-842-2357-23431629236ref|WP_008810699.1|peptide ABC transporter ATP-binding protein [Burkholderiales...
1202533Bacillus nealsonii AAU14 (0.1%)2E-837-2424-24131429246ref|WP_016202695.1|glutamine ABC transporter ATP-binding protein [Bacillus neal...
314608Shewanella benthica KT991 (0.03%)3E-826-2351-22431129232ref|WP_005501268.1|peptide ABC transporter ATP-binding protein [Shewanella bent...
866775Aerococcus urinae ACS-120-V-Col10a2 (0.05%)5E-826-2412-23231029238ref|YP_004321747.1|glutamine ABC transporter ATP-binding protein GlnQ [Aerococc...
420247Methanobrevibacter smithii ATCC 350611 (0.03%)3E-736-2443-22728129246ref|YP_001273378.1|polar amino acid ABC transporter, ATPase component [Methanob...
1151391Clostridium difficile Y3841 (0.03%)4E-724-2403-22927729237ref|YP_005353875.1|Spermidine/putrescine import ATP-binding protein PotA [Enter...
457421Clostridiales bacterium 1_7_47FAA3 (0.07%)3E-861-2351-22732428237ref|WP_008716170.1|peptide ABC transporter ATP-binding protein [Clostridiales b...
997296Bacillus methanolicus PB12 (0.05%)3E-856-2431-23532128243ref|WP_003350565.1|amino acid ABC transporter ATPase [Bacillus methanolicus] gb...
1246477Brevibacillus agri BAB-25004 (0.1%)1E-846-2411-23031928238ref|WP_005835001.1|amino acid ABC transporter ATPase [Brevibacillus] gb|EJL4428...
1008452Streptococcus mitis SK10731 (0.03%)1E-831-2371-23031528239ref|WP_000140956.1|peptide ABC transporter ATP-binding protein [Streptococcus m...
1144308Brevibacillus sp. BC256 (0.15%)2E-836-2411-23031528238ref|WP_007715956.1|amino acid ABC transporter ATPase [Brevibacillus sp. BC25] g...
760835Streptococcus pneumoniae GA473731 (0.03%)2E-836-2371-22631428234ref|WP_001836109.1|peptide ABC transporter ATP-binding protein [Streptococcus p...
1239786Streptococcus pneumoniae 8011 (0.03%)2E-831-2371-23031428239ref|WP_000140961.1|peptide ABC transporter ATP-binding protein [Streptococcus p...
1078085Paenisporosarcina sp. HGH00302 (0.05%)2E-836-2421-23931428247ref|WP_016428586.1|hypothetical protein [Paenisporosarcina sp. HGH0030] gb|EPD5...
1035187Streptococcus mitis SK5691 (0.03%)2E-831-2371-23031428239ref|WP_000169047.1|peptide ABC transporter ATP-binding protein [Streptococcus m...
760788Streptococcus pneumoniae GA174841 (0.03%)3E-831-2371-23031428239ref|WP_000140965.1|peptide ABC transporter ATP-binding protein [Streptococcus p...
1393Brevibacillus brevis6 (0.15%)3E-836-2411-23031428238ref|WP_017247419.1|amino acid ABC transporter ATPase [Brevibacillus brevis]
1239789Streptococcus pneumoniae 14881 (0.03%)4E-831-2371-23031428239ref|WP_000140967.1|peptide ABC transporter ATP-binding protein [Streptococcus p...






Robetta is available for NON-COMMERCIAL USE ONLY at this time
[ Terms of Service ]
Copyright © 2004-2011 University of Washington