old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240
	MENKPILSFEKVSIIYKKAPLLQNISFKVMAKENVCLLGKSGVGKSSLLNSVTNTKIVKSGLVYFDGVASNKKEYKKLKKQCSYLDQIPNLIDTDYVYEAILRSAKQKLTWLQKLICFEPKWIKDKILAILKEVNLNDYVSCIIKDLSAGQKQRVEIAKLFFKSPKLLLVDEPTTGLDPLTASKIMDLITDFVKREKITLVFVTHDIDLALKYSTRIIALKNHALVLDRLTEKLTKEQLYKIYDN
tmhmm (0)	-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)	-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (2%)	XXX-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------X
psipred	-----EEEEEEEEEEE---EEE--EEEEE----EEEEE------HHHHHHHHH--------EEEE--EE-----HHHHHHH--EEE----------HHHHHHH------HHHHHH----HHHHHHHHHHHHHH---HHHH----HH--HHHHHHHHHHHHHH----EEEE--------HHHHHHHHHHHHHHHHHH--EEEEE---HHHHHHH--EEEEEE--EEEEE--HHHHHHHHHHHHH--

# SignalP-4.0 gram- predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    32	    0.447
  max. Y    32	    0.249
  max. S    31	    0.193
  mean S     1-31   0.136
       D     1-31   0.196    0.570  NO
Name=tmp_signalp_seq	SP='NO' D=0.196 D-cutoff=0.570 Networks=SignalP-noTM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-245	alignment	4wbsB_202	1-257	0.8694	--

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
411465	Parvimonas micra ATCC 33270	1 (0.03%)	3E-72	1-243	1-246	277	32	247	ref|WP_004833162.1|	phosphonate ABC transporter ATP-binding protein [Parvimonas ...
403833	Petrotoga mobilis SJ95	1 (0.03%)	5E-76	2-238	4-233	290	30	238	ref|YP_001568673.1|	ABC transporter-like protein [Petrotoga mobilis SJ95] ref|WP...
762966	Parasutterella excrementihominis YIT 11859	2 (0.05%)	6E-84	2-235	7-234	316	29	236	ref|WP_008810699.1|	peptide ABC transporter ATP-binding protein [Burkholderiales...
1202533	Bacillus nealsonii AAU1	4 (0.1%)	2E-83	7-242	4-241	314	29	246	ref|WP_016202695.1|	glutamine ABC transporter ATP-binding protein [Bacillus neal...
314608	Shewanella benthica KT99	1 (0.03%)	3E-82	6-235	1-224	311	29	232	ref|WP_005501268.1|	peptide ABC transporter ATP-binding protein [Shewanella bent...
866775	Aerococcus urinae ACS-120-V-Col10a	2 (0.05%)	5E-82	6-241	2-232	310	29	238	ref|YP_004321747.1|	glutamine ABC transporter ATP-binding protein GlnQ [Aerococc...
420247	Methanobrevibacter smithii ATCC 35061	1 (0.03%)	3E-73	6-244	3-227	281	29	246	ref|YP_001273378.1|	polar amino acid ABC transporter, ATPase component [Methanob...
1151391	Clostridium difficile Y384	1 (0.03%)	4E-72	4-240	3-229	277	29	237	ref|YP_005353875.1|	Spermidine/putrescine import ATP-binding protein PotA [Enter...
457421	Clostridiales bacterium 1_7_47FAA	3 (0.07%)	3E-86	1-235	1-227	324	28	237	ref|WP_008716170.1|	peptide ABC transporter ATP-binding protein [Clostridiales b...
997296	Bacillus methanolicus PB1	2 (0.05%)	3E-85	6-243	1-235	321	28	243	ref|WP_003350565.1|	amino acid ABC transporter ATPase [Bacillus methanolicus] gb...
1246477	Brevibacillus agri BAB-2500	4 (0.1%)	1E-84	6-241	1-230	319	28	238	ref|WP_005835001.1|	amino acid ABC transporter ATPase [Brevibacillus] gb|EJL4428...
1008452	Streptococcus mitis SK1073	1 (0.03%)	1E-83	1-237	1-230	315	28	239	ref|WP_000140956.1|	peptide ABC transporter ATP-binding protein [Streptococcus m...
1144308	Brevibacillus sp. BC25	6 (0.15%)	2E-83	6-241	1-230	315	28	238	ref|WP_007715956.1|	amino acid ABC transporter ATPase [Brevibacillus sp. BC25] g...
760835	Streptococcus pneumoniae GA47373	1 (0.03%)	2E-83	6-237	1-226	314	28	234	ref|WP_001836109.1|	peptide ABC transporter ATP-binding protein [Streptococcus p...
1239786	Streptococcus pneumoniae 801	1 (0.03%)	2E-83	1-237	1-230	314	28	239	ref|WP_000140961.1|	peptide ABC transporter ATP-binding protein [Streptococcus p...
1078085	Paenisporosarcina sp. HGH0030	2 (0.05%)	2E-83	6-242	1-239	314	28	247	ref|WP_016428586.1|	hypothetical protein [Paenisporosarcina sp. HGH0030] gb|EPD5...
1035187	Streptococcus mitis SK569	1 (0.03%)	2E-83	1-237	1-230	314	28	239	ref|WP_000169047.1|	peptide ABC transporter ATP-binding protein [Streptococcus m...
760788	Streptococcus pneumoniae GA17484	1 (0.03%)	3E-83	1-237	1-230	314	28	239	ref|WP_000140965.1|	peptide ABC transporter ATP-binding protein [Streptococcus p...
1393	Brevibacillus brevis	6 (0.15%)	3E-83	6-241	1-230	314	28	238	ref|WP_017247419.1|	amino acid ABC transporter ATPase [Brevibacillus brevis]
1239789	Streptococcus pneumoniae 1488	1 (0.03%)	4E-83	1-237	1-230	314	28	239	ref|WP_000140967.1|	peptide ABC transporter ATP-binding protein [Streptococcus p...