old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210
	MGKYQPSFQTKKGWTEVICGPMFSGKTEKLLHKIKRWKIAKISVVIFKPIIDTRQTNIVKSRNGEYDQAITINSPFEIYDHLVDKNYQIVAIDEAQFFSNEIIEVVTTLNEIGTNVIISGLDTDFRAEPFGCIPQLLAIADVVNKLDAICNVCGSLAQRTQRLVNKNTNDNLVLIGDAEAYEARCKLHHSFLTKKHVTVKTKNFKEQVQGKTQ
tmhmm (0)	---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)	---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (18%)	XXXXXXXXXXXXXX-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXXXXXXXXXXXXXXXXX
psipred	------------EEEEEEE-----HHHHHHHHHHHHHHHH--EEEEEEE--------EE------EEEEEE---HHHHHHHHHH---EEEEE--HHH--HHHHHHHHHHHH---EEEEEEE---HH----HHHHHHHHH---EEEE-EEE-----EEEEEEEE--------EEEE-----EEEE-HHHHH-----HHHHHHHHHHHHH-----

# SignalP-4.0 gram- predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    55	    0.103
  max. Y     8	    0.133
  max. S     4	    0.223
  mean S     1-7    0.191
       D     1-7    0.160    0.570  NO
Name=tmp_signalp_seq	SP='NO' D=0.160 D-cutoff=0.570 Networks=SignalP-noTM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-213	alignment	2uz3A_203	1-190	0.7735	TRANSFERASE

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
662947	Mycoplasma genitalium M2288	1 (0.04%)	2E-70	1-213	1-213	271	100	213	ref|YP_006601042.1|	thymidine kinase [Mycoplasma genitalium M2288] ref|WP_014894...
662945	Mycoplasma genitalium M6320	1 (0.04%)	3E-70	1-213	1-213	270	100	213	ref|NP_072694.1|	thymidine kinase [Mycoplasma genitalium G37] ref|YP_00659955...
662946	Mycoplasma genitalium M6282	1 (0.04%)	2E-69	1-213	1-213	267	99	213	ref|YP_006600045.1|	thymidine kinase [Mycoplasma genitalium M6282] ref|WP_014894...
272634	Mycoplasma pneumoniae M129	1 (0.04%)	2E-61	1-188	1-186	241	70	188	ref|NP_109732.1|	thymidine kinase [Mycoplasma pneumoniae M129] ref|WP_0108744...
722438	Mycoplasma pneumoniae FH	1 (0.04%)	1E-64	1-209	9-214	252	68	209	ref|YP_005881088.1|	thymidine kinase [Mycoplasma pneumoniae FH] ref|WP_014574851...
1238993	Mycoplasma pneumoniae M129-B7	1 (0.04%)	3E-64	1-209	1-206	250	68	209	ref|YP_005175277.1|	thymidine kinase [Mycoplasma pneumoniae 309] ref|YP_00734767...
0	UNIDENTIFIED	153 (6.59%)	1E-71	10-197	5-195	275	49	192	ref|YP_008419318.1|	thymidine kinase [Geobacillus sp. JF8] ref|WP_020961524.1| t...
857293	Caloramator australicus RC3	1 (0.04%)	4E-67	9-193	4-191	260	49	189	ref|WP_008907718.1|	thymidine kinase [Caloramator australicus] emb|CCC58000.1| T...
991791	Clostridium acetobutylicum DSM 1731	1 (0.04%)	3E-66	9-197	4-195	257	49	193	ref|NP_349490.1|	thymidine kinase [Clostridium acetobutylicum ATCC 824] ref|Y...
81408	Geobacillus caldoxylosilyticus	1 (0.04%)	1E-72	10-203	5-201	278	48	198	ref|WP_017436893.1|	thymidine kinase [Geobacillus caldoxylosilyticus]
471223	Geobacillus sp. WCH70	1 (0.04%)	1E-72	10-203	5-201	278	48	198	ref|YP_002951232.1|	thymidine kinase [Geobacillus sp. WCH70] ref|WP_015865330.1|...
495036	Geobacillus sp. G11MC16	1 (0.04%)	2E-72	10-199	5-197	277	48	194	ref|YP_001127409.1|	thymidine kinase [Geobacillus thermodenitrificans NG80-2] re...
1136178	Geobacillus thermoglucosidans TNO-09.020	1 (0.04%)	5E-72	10-205	5-203	276	48	200	ref|YP_003990959.1|	thymidine kinase [Geobacillus sp. Y4.1MC1] ref|YP_004589721....
33931	Bacillus caldovelox	1 (0.04%)	7E-72	10-201	5-199	276	48	196	dbj|BAK69314.1|	thymidine kinase [Bacillus caldovelox]
1394	Bacillus caldolyticus	1 (0.04%)	1E-71	10-201	5-199	275	48	196	dbj|BAK69312.1|	thymidine kinase [Bacillus caldolyticus]
1462	Geobacillus kaustophilus	1 (0.04%)	2E-71	10-200	5-198	274	48	195	ref|YP_149233.1|	thymidine kinase [Geobacillus kaustophilus HTA426] ref|WP_01...
550542	Geobacillus sp. Y412MC52	1 (0.04%)	3E-71	10-201	5-199	274	48	196	ref|YP_003254467.1|	thymidine kinase [Geobacillus sp. Y412MC61] ref|YP_003672855...
33938	Geobacillus thermocatenulatus	1 (0.04%)	1E-70	10-201	5-199	271	48	196	dbj|BAK69315.1|	thymidine kinase [Geobacillus thermocatenulatus]
1211706	Paenisporosarcina sp. TG20	1 (0.04%)	2E-69	10-192	5-190	268	48	187	ref|WP_019415000.1|	thymidine kinase [Paenisporosarcina sp. TG20]
1178537	Bacillus sp. HYC-10	1 (0.04%)	4E-68	10-192	5-190	263	48	187	ref|WP_008354973.1|	thymidine kinase [Bacillus sp. HYC-10] gb|EKF37292.1| thymid...