| Features and Secondary Structure |
| | 1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 |
| | MGKYQPSFQTKKGWTEVICGPMFSGKTEKLLHKIKRWKIAKISVVIFKPIIDTRQTNIVKSRNGEYDQAITINSPFEIYDHLVDKNYQIVAIDEAQFFSNEIIEVVTTLNEIGTNVIISGLDTDFRAEPFGCIPQLLAIADVVNKLDAICNVCGSLAQRTQRLVNKNTNDNLVLIGDAEAYEARCKLHHSFLTKKHVTVKTKNFKEQVQGKTQ |
| tmhmm (0) | --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| low complexity (0%) | --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| coiled-coils (0%) | --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| disordered (18%) | XXXXXXXXXXXXXX-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXXXXXXXXXXXXXXXXX |
| psipred | ------------EEEEEEE-----HHHHHHHHHHHHHHHH--EEEEEEE--------EE------EEEEEE---HHHHHHHHHH---EEEEE--HHH--HHHHHHHHHHHH---EEEEEEE---HH----HHHHHHHHH---EEEE-EEE-----EEEEEEEE--------EEEE-----EEEE-HHHHH-----HHHHHHHHHHHHH----- |
PSI-BLAST Sequence Hits (Top 20 by Identity) ALL DATA
|
| TaxID |
Species |
Alignments |
PSI-Blast Data (alignment with lowest E value) |
| E value |
Query Span |
Sbjct Span |
Bit Score |
Identity |
HSP Length |
Accession |
Description |
| 662947 | Mycoplasma genitalium M2288 | 1 (0.04%) | 2E-70 | 1-213 | 1-213 | 271 | 100 | 213 | ref|YP_006601042.1| | thymidine kinase [Mycoplasma genitalium M2288] ref|WP_014894... |
| 662945 | Mycoplasma genitalium M6320 | 1 (0.04%) | 3E-70 | 1-213 | 1-213 | 270 | 100 | 213 | ref|NP_072694.1| | thymidine kinase [Mycoplasma genitalium G37] ref|YP_00659955... |
| 662946 | Mycoplasma genitalium M6282 | 1 (0.04%) | 2E-69 | 1-213 | 1-213 | 267 | 99 | 213 | ref|YP_006600045.1| | thymidine kinase [Mycoplasma genitalium M6282] ref|WP_014894... |
| 272634 | Mycoplasma pneumoniae M129 | 1 (0.04%) | 2E-61 | 1-188 | 1-186 | 241 | 70 | 188 | ref|NP_109732.1| | thymidine kinase [Mycoplasma pneumoniae M129] ref|WP_0108744... |
| 722438 | Mycoplasma pneumoniae FH | 1 (0.04%) | 1E-64 | 1-209 | 9-214 | 252 | 68 | 209 | ref|YP_005881088.1| | thymidine kinase [Mycoplasma pneumoniae FH] ref|WP_014574851... |
| 1238993 | Mycoplasma pneumoniae M129-B7 | 1 (0.04%) | 3E-64 | 1-209 | 1-206 | 250 | 68 | 209 | ref|YP_005175277.1| | thymidine kinase [Mycoplasma pneumoniae 309] ref|YP_00734767... |
| 0 | UNIDENTIFIED | 153 (6.59%) | 1E-71 | 10-197 | 5-195 | 275 | 49 | 192 | ref|YP_008419318.1| | thymidine kinase [Geobacillus sp. JF8] ref|WP_020961524.1| t... |
| 857293 | Caloramator australicus RC3 | 1 (0.04%) | 4E-67 | 9-193 | 4-191 | 260 | 49 | 189 | ref|WP_008907718.1| | thymidine kinase [Caloramator australicus] emb|CCC58000.1| T... |
| 991791 | Clostridium acetobutylicum DSM 1731 | 1 (0.04%) | 3E-66 | 9-197 | 4-195 | 257 | 49 | 193 | ref|NP_349490.1| | thymidine kinase [Clostridium acetobutylicum ATCC 824] ref|Y... |
| 81408 | Geobacillus caldoxylosilyticus | 1 (0.04%) | 1E-72 | 10-203 | 5-201 | 278 | 48 | 198 | ref|WP_017436893.1| | thymidine kinase [Geobacillus caldoxylosilyticus] |
| 471223 | Geobacillus sp. WCH70 | 1 (0.04%) | 1E-72 | 10-203 | 5-201 | 278 | 48 | 198 | ref|YP_002951232.1| | thymidine kinase [Geobacillus sp. WCH70] ref|WP_015865330.1|... |
| 495036 | Geobacillus sp. G11MC16 | 1 (0.04%) | 2E-72 | 10-199 | 5-197 | 277 | 48 | 194 | ref|YP_001127409.1| | thymidine kinase [Geobacillus thermodenitrificans NG80-2] re... |
| 1136178 | Geobacillus thermoglucosidans TNO-09.020 | 1 (0.04%) | 5E-72 | 10-205 | 5-203 | 276 | 48 | 200 | ref|YP_003990959.1| | thymidine kinase [Geobacillus sp. Y4.1MC1] ref|YP_004589721.... |
| 33931 | Bacillus caldovelox | 1 (0.04%) | 7E-72 | 10-201 | 5-199 | 276 | 48 | 196 | dbj|BAK69314.1| | thymidine kinase [Bacillus caldovelox] |
| 1394 | Bacillus caldolyticus | 1 (0.04%) | 1E-71 | 10-201 | 5-199 | 275 | 48 | 196 | dbj|BAK69312.1| | thymidine kinase [Bacillus caldolyticus] |
| 1462 | Geobacillus kaustophilus | 1 (0.04%) | 2E-71 | 10-200 | 5-198 | 274 | 48 | 195 | ref|YP_149233.1| | thymidine kinase [Geobacillus kaustophilus HTA426] ref|WP_01... |
| 550542 | Geobacillus sp. Y412MC52 | 1 (0.04%) | 3E-71 | 10-201 | 5-199 | 274 | 48 | 196 | ref|YP_003254467.1| | thymidine kinase [Geobacillus sp. Y412MC61] ref|YP_003672855... |
| 33938 | Geobacillus thermocatenulatus | 1 (0.04%) | 1E-70 | 10-201 | 5-199 | 271 | 48 | 196 | dbj|BAK69315.1| | thymidine kinase [Geobacillus thermocatenulatus] |
| 1211706 | Paenisporosarcina sp. TG20 | 1 (0.04%) | 2E-69 | 10-192 | 5-190 | 268 | 48 | 187 | ref|WP_019415000.1| | thymidine kinase [Paenisporosarcina sp. TG20] |
| 1178537 | Bacillus sp. HYC-10 | 1 (0.04%) | 4E-68 | 10-192 | 5-190 | 263 | 48 | 187 | ref|WP_008354973.1| | thymidine kinase [Bacillus sp. HYC-10] gb|EKF37292.1| thymid... |