old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280 . 290 . 300 . 310
	MKKGNKTVWNECIDILDNVKSPSFSANFDDYFKKSKSKPPKKNKKVLNNIKKAELKLKKKANKKQKANTLYIPPFAQQAKGIVITINKMWKNVHNDDSKQEISILSDVSLQIAYGEIVIILGSSGSGKTTLLNLIGGYDSISLGSCIVANCPLEKCTSEQLLTYRKNNLGYVYQRYNLIELLSAYDNIAISQNLIPKYQRRLDIEELAEKLDIKEILYKFPYEMSGGQKQRVAIARAIIKEPKLLLCDEPTGALDSNSAENIINLLQTINKTYKQTILMVTHDVSLTRIANRIIKISDGKIVSNQLVRPLV
tmhmm (0)	-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (12%)	--------------------------------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (9%)	------------------------------------------XXXXXXXXXXXXXXXXXXXXXXXXXXXX-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (11%)	XXXX---X--------------------------XXXXXXXXXXXXXXXXXXXXXXXXXXX---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------X
psipred	-------HHHHHHHH------------HHHH------------HHHH----HHHH---------------------------EEEEEEEEEEE------EEEEEE---EEEE----EEEEE------HHHHHHHHH-------EEEEE--EE-----HHHHHHHHHH---EEEE---------HHHHHHHHHHH----HHHHHHHHHHHH---HHHHH-------HHHHHHHHHHHHHH----EEEE-----HHHHHHHHHHHHHHHHHHHH---EEEEE---HHHHHH--EEEEEE--EEE--EE-----

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    26	    0.152
  max. Y    26	    0.157
  max. S    33	    0.219
  mean S     1-25   0.154
       D     1-25   0.156    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.156 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-311	alignment	5koyA_202	1-1182	0.6889	--

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
663918	Mycoplasma genitalium M2321	1 (0.03%)	9E-93	1-311	1-311	346	100	311	ref|NP_073137.1|	ABC transporter ATP-binding protein [Mycoplasma genitalium G...
662945	Mycoplasma genitalium M6320	1 (0.03%)	1E-92	1-311	1-311	346	99	311	ref|YP_006601006.1|	ABC transporter ATP-binding protein [Mycoplasma genitalium M...
662947	Mycoplasma genitalium M2288	1 (0.03%)	1E-92	1-311	1-311	346	99	311	ref|YP_006600497.1|	ABC transporter ATP-binding protein [Mycoplasma genitalium M...
1112856	Mycoplasma pneumoniae 309	1 (0.03%)	4E-73	2-310	7-338	281	70	332	ref|YP_005175934.1|	ABC transporter ATP-binding protein [Mycoplasma pneumoniae 3...
1238993	Mycoplasma pneumoniae M129-B7	1 (0.03%)	1E-72	2-310	7-338	280	69	332	ref|NP_110372.1|	ABC transporter [Mycoplasma pneumoniae M129] ref|YP_00734823...
2104	Mycoplasma pneumoniae	1 (0.03%)	2E-72	2-310	7-338	279	69	332	ref|WP_019830485.1|	ABC transporter ATP-binding protein [Mycoplasma pneumoniae]
428126	Clostridium spiroforme DSM 1552	5 (0.12%)	6E-71	83-304	4-225	274	44	224	ref|WP_004610538.1|	multidrug ABC transporter ATP-binding protein [[Clostridium]...
658085	Lachnospiraceae bacterium 5_1_57FAA	10 (0.25%)	2E-77	83-302	3-221	295	43	221	ref|WP_009249814.1|	ABC transporter ATP-binding protein [Lachnospiraceae bacteri...
457412	Ruminococcus sp. 5_1_39BFAA	5 (0.12%)	6E-79	83-302	3-221	300	42	221	ref|WP_008707470.1|	ABC transporter ATP-binding protein [Ruminococcus sp. 5_1_39...
439220	Streptococcus caballi	2 (0.05%)	8E-73	82-304	1-224	280	42	225	ref|WP_018364718.1|	ABC transporter ATP-binding protein [Streptococcus caballi]
195103	Clostridium perfringens ATCC 13124	1 (0.03%)	2E-71	83-304	4-225	275	42	224	ref|YP_695292.1|	ABC transporter ATP-binding protein [Clostridium perfringens...
445334	Clostridium perfringens C str. JGS1495	2 (0.05%)	4E-71	83-304	4-225	274	42	224	ref|WP_003449271.1|	multidrug ABC transporter ATP-binding protein [Clostridium p...
471875	Ruminococcus lactaris ATCC 29176	2 (0.05%)	8E-71	83-304	24-245	273	42	224	ref|WP_005611923.1|	multidrug ABC transporter ATP-binding protein [Ruminococcus ...
1235799	Lachnospiraceae bacterium 3-2	5 (0.12%)	5E-77	83-302	3-221	294	41	221	ref|WP_016226033.1|	hypothetical protein [Lachnospiraceae bacterium 3-2] gb|EOS6...
313627	Bacillus sp. NRRL B-14911	1 (0.03%)	2E-74	83-309	3-227	285	41	227	ref|YP_008611805.1|	peptide ABC transporter ATP-binding protein [Bacillus infant...
536231	Roseburia intestinalis L1-82	4 (0.1%)	4E-74	82-308	2-226	284	41	227	ref|WP_006856545.1|	peptide ABC transporter ATP-binding protein [Roseburia intes...
742737	Clostridium hathewayi WAL-18680	3 (0.07%)	7E-73	83-309	3-227	280	41	227	ref|WP_006778262.1|	peptide ABC transporter ATP-binding protein [Clostridium hat...
411470	Ruminococcus gnavus ATCC 29149	3 (0.07%)	9E-72	81-304	2-225	277	41	226	ref|WP_004840998.1|	multidrug ABC transporter ATP-binding protein [[Ruminococcus...
1226336	Lactobacillus helveticus CIRM-BIA 101	1 (0.03%)	8E-72	81-304	2-226	277	41	226	ref|WP_003627811.1|	bacitracin ABC transporter ATP-binding protein [Lactobacillu...
1005706	Streptococcus dysgalactiae subsp. equisimilis SK1250	1 (0.03%)	3E-71	82-304	7-230	275	41	225	ref|WP_003061087.1|	ABC transporter ATP-binding protein [Streptococcus dysgalact...