| Features and Secondary Structure |
| | 1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280 . 290 . 300 . 310 |
| | MKKGNKTVWNECIDILDNVKSPSFSANFDDYFKKSKSKPPKKNKKVLNNIKKAELKLKKKANKKQKANTLYIPPFAQQAKGIVITINKMWKNVHNDDSKQEISILSDVSLQIAYGEIVIILGSSGSGKTTLLNLIGGYDSISLGSCIVANCPLEKCTSEQLLTYRKNNLGYVYQRYNLIELLSAYDNIAISQNLIPKYQRRLDIEELAEKLDIKEILYKFPYEMSGGQKQRVAIARAIIKEPKLLLCDEPTGALDSNSAENIINLLQTINKTYKQTILMVTHDVSLTRIANRIIKISDGKIVSNQLVRPLV |
| tmhmm (0) | ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| low complexity (12%) | --------------------------------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| coiled-coils (9%) | ------------------------------------------XXXXXXXXXXXXXXXXXXXXXXXXXXXX------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| disordered (11%) | XXXX---X--------------------------XXXXXXXXXXXXXXXXXXXXXXXXXXX---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------X |
| psipred | -------HHHHHHHH------------HHHH------------HHHH----HHHH---------------------------EEEEEEEEEEE------EEEEEE---EEEE----EEEEE------HHHHHHHHH-------EEEEE--EE-----HHHHHHHHHH---EEEE---------HHHHHHHHHHH----HHHHHHHHHHHH---HHHHH-------HHHHHHHHHHHHHH----EEEE-----HHHHHHHHHHHHHHHHHHHH---EEEEE---HHHHHH--EEEEEE--EEE--EE----- |
PSI-BLAST Sequence Hits (Top 20 by Identity) ALL DATA
|
| TaxID |
Species |
Alignments |
PSI-Blast Data (alignment with lowest E value) |
| E value |
Query Span |
Sbjct Span |
Bit Score |
Identity |
HSP Length |
Accession |
Description |
| 663918 | Mycoplasma genitalium M2321 | 1 (0.03%) | 9E-93 | 1-311 | 1-311 | 346 | 100 | 311 | ref|NP_073137.1| | ABC transporter ATP-binding protein [Mycoplasma genitalium G... |
| 662945 | Mycoplasma genitalium M6320 | 1 (0.03%) | 1E-92 | 1-311 | 1-311 | 346 | 99 | 311 | ref|YP_006601006.1| | ABC transporter ATP-binding protein [Mycoplasma genitalium M... |
| 662947 | Mycoplasma genitalium M2288 | 1 (0.03%) | 1E-92 | 1-311 | 1-311 | 346 | 99 | 311 | ref|YP_006600497.1| | ABC transporter ATP-binding protein [Mycoplasma genitalium M... |
| 1112856 | Mycoplasma pneumoniae 309 | 1 (0.03%) | 4E-73 | 2-310 | 7-338 | 281 | 70 | 332 | ref|YP_005175934.1| | ABC transporter ATP-binding protein [Mycoplasma pneumoniae 3... |
| 1238993 | Mycoplasma pneumoniae M129-B7 | 1 (0.03%) | 1E-72 | 2-310 | 7-338 | 280 | 69 | 332 | ref|NP_110372.1| | ABC transporter [Mycoplasma pneumoniae M129] ref|YP_00734823... |
| 2104 | Mycoplasma pneumoniae | 1 (0.03%) | 2E-72 | 2-310 | 7-338 | 279 | 69 | 332 | ref|WP_019830485.1| | ABC transporter ATP-binding protein [Mycoplasma pneumoniae] |
| 428126 | Clostridium spiroforme DSM 1552 | 5 (0.12%) | 6E-71 | 83-304 | 4-225 | 274 | 44 | 224 | ref|WP_004610538.1| | multidrug ABC transporter ATP-binding protein [[Clostridium]... |
| 658085 | Lachnospiraceae bacterium 5_1_57FAA | 10 (0.25%) | 2E-77 | 83-302 | 3-221 | 295 | 43 | 221 | ref|WP_009249814.1| | ABC transporter ATP-binding protein [Lachnospiraceae bacteri... |
| 457412 | Ruminococcus sp. 5_1_39BFAA | 5 (0.12%) | 6E-79 | 83-302 | 3-221 | 300 | 42 | 221 | ref|WP_008707470.1| | ABC transporter ATP-binding protein [Ruminococcus sp. 5_1_39... |
| 439220 | Streptococcus caballi | 2 (0.05%) | 8E-73 | 82-304 | 1-224 | 280 | 42 | 225 | ref|WP_018364718.1| | ABC transporter ATP-binding protein [Streptococcus caballi] |
| 195103 | Clostridium perfringens ATCC 13124 | 1 (0.03%) | 2E-71 | 83-304 | 4-225 | 275 | 42 | 224 | ref|YP_695292.1| | ABC transporter ATP-binding protein [Clostridium perfringens... |
| 445334 | Clostridium perfringens C str. JGS1495 | 2 (0.05%) | 4E-71 | 83-304 | 4-225 | 274 | 42 | 224 | ref|WP_003449271.1| | multidrug ABC transporter ATP-binding protein [Clostridium p... |
| 471875 | Ruminococcus lactaris ATCC 29176 | 2 (0.05%) | 8E-71 | 83-304 | 24-245 | 273 | 42 | 224 | ref|WP_005611923.1| | multidrug ABC transporter ATP-binding protein [Ruminococcus ... |
| 1235799 | Lachnospiraceae bacterium 3-2 | 5 (0.12%) | 5E-77 | 83-302 | 3-221 | 294 | 41 | 221 | ref|WP_016226033.1| | hypothetical protein [Lachnospiraceae bacterium 3-2] gb|EOS6... |
| 313627 | Bacillus sp. NRRL B-14911 | 1 (0.03%) | 2E-74 | 83-309 | 3-227 | 285 | 41 | 227 | ref|YP_008611805.1| | peptide ABC transporter ATP-binding protein [Bacillus infant... |
| 536231 | Roseburia intestinalis L1-82 | 4 (0.1%) | 4E-74 | 82-308 | 2-226 | 284 | 41 | 227 | ref|WP_006856545.1| | peptide ABC transporter ATP-binding protein [Roseburia intes... |
| 742737 | Clostridium hathewayi WAL-18680 | 3 (0.07%) | 7E-73 | 83-309 | 3-227 | 280 | 41 | 227 | ref|WP_006778262.1| | peptide ABC transporter ATP-binding protein [Clostridium hat... |
| 411470 | Ruminococcus gnavus ATCC 29149 | 3 (0.07%) | 9E-72 | 81-304 | 2-225 | 277 | 41 | 226 | ref|WP_004840998.1| | multidrug ABC transporter ATP-binding protein [[Ruminococcus... |
| 1226336 | Lactobacillus helveticus CIRM-BIA 101 | 1 (0.03%) | 8E-72 | 81-304 | 2-226 | 277 | 41 | 226 | ref|WP_003627811.1| | bacitracin ABC transporter ATP-binding protein [Lactobacillu... |
| 1005706 | Streptococcus dysgalactiae subsp. equisimilis SK1250 | 1 (0.03%) | 3E-71 | 82-304 | 7-230 | 275 | 41 | 225 | ref|WP_003061087.1| | ABC transporter ATP-binding protein [Streptococcus dysgalact... |