old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280 . 290 . 300 . 310 . 320 . 330 . 340 . 350 . 360
	MLSAGIVGLPNVGKSTLFSAITNLQVEIANYPFATIEPNTGIVNVSDERLDKLASLINPEKIVYTTFRFVDIAGLVKGASQGQGLGNQFLANIREVDLICHVVRCFQDKKIVHVNNTIDPVFDFEIIVNELIQADFELITNRIGKLKRKAESGDKIAKEEFVLLEIVLNGLKQGQMPIQTLSESELKTIKSLNLLTAKPILIVANVSENDLLNLDNNEALKKLNAFLDQKKIPKAITVCSLIEKELSGLKLEQRQYFLDELGLKNYSGLNRVIQAAYQTLNLWSFFTFGKKEVRAWTFKKGWNAPQCAGQIHSDFEKGFIKVEVISWDQLFAMKSLQEAKKQGLIRLEGKNYLIKDGDVCNFKFNVT
tmhmm (0)	-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (5%)	---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXXXXXXXXXXX----------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (6%)	X---------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXXXXXXXXX------------------XXXXX------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
psipred	--EEEEE------HHHHHHHHH----------------EEEEEE-----HHHHHHHH--------EEEEEE------HHH-----HHHHHHHHHHH-EEEEEEEE--------------HHHHHHHHHH------HHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHHH----EEE----HHH---HHHHHHHHHHHHHHH------EEEEHHHHHHHHH----HHHHHHHHHH-------HHHHHHHHHHH--EEEEE---------EE------HHHHHHHHHHHHHHH-EEEEE--HHHHHH---HHHHHH----------EEE----EEEEEEE--

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    35	    0.223
  max. Y    35	    0.249
  max. S    14	    0.415
  mean S     1-34   0.307
       D     1-34   0.272    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.272 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-367	alignment	1jalA_202	1-348	0.9040	STRUCTURAL GENOMICS, UNKNOWN FUNCTION

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
1238993	Mycoplasma pneumoniae M129-B7	1 (0.03%)	1E-114	1-366	1-366	417	75	366	ref|YP_005175258.1|	GTP-binding protein YchF [Mycoplasma pneumoniae 309] ref|YP_...
340047	Mycoplasma capricolum subsp. capricolum ATCC 27343	1 (0.03%)	2E-50	2-174	3-175	206	62	173	emb|CAA83699.1|	similar to GTP-bind. GTP1/OBG family [Mycoplasma capricolum ...
443342	candidate division TM7 genomosp. GTL1	2 (0.05%)	8E-46	2-158	3-159	190	59	157	ref|WP_008578825.1|	GTP-binding protein [candidate division TM7 genomosp. GTL1] ...
626096	Ureaplasma urealyticum serovar 2 str. ATCC 27814	1 (0.03%)	1E-113	2-367	3-367	414	57	367	ref|YP_002285050.1|	GTP-dependent nucleic acid-binding protein EngD [Ureaplasma ...
910310	Turicibacter sp. HGF1	1 (0.03%)	1E-123	2-366	3-366	446	55	366	ref|WP_006784579.1|	GTP-binding protein YchF [Turicibacter] gb|EFF63798.1| GTP-b...
862259	Mycoplasma mycoides subsp. capri LC str. 95010	1 (0.03%)	1E-118	2-366	3-364	432	55	366	ref|YP_004400584.1|	GTP binding protein [Mycoplasma mycoides subsp. capri LC str...
1188246	Mycoplasma mycoides subsp. capri PG3	1 (0.03%)	1E-118	2-366	3-364	432	55	366	ref|WP_017698114.1|	GTP-binding protein YchF [Mycoplasma mycoides] gb|ACU78419.1...
94136	Alkalibacillus haloalkaliphilus	1 (0.03%)	1E-129	2-366	3-366	467	54	366	ref|WP_017185417.1|	GTP-binding protein YchF [Alkalibacillus haloalkaliphilus]
51173	Ureibacillus thermosphaericus	1 (0.03%)	1E-127	2-366	3-366	460	54	366	ref|WP_016838918.1|	GTP-binding protein YchF [Ureibacillus thermosphaericus]
1321820	Gemella bergeriae ATCC 700627	1 (0.03%)	1E-124	2-366	3-366	453	54	366	ref|WP_021752543.1|	GTP-binding protein YchF [Gemella bergeri] gb|ERK56721.1| GT...
156578	Alteromonadales bacterium TW-7	2 (0.05%)	4E-37	280-366	1-87	162	54	87	ref|WP_006793419.1|	GTP-dependent nucleic acid-binding protein engD, partial [Al...
521098	Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446	1 (0.03%)	1E-130	2-366	3-366	472	53	366	ref|YP_003186323.1|	GTP-binding protein YchF [Alicyclobacillus acidocaldarius su...
301148	Caldibacillus debilis	1 (0.03%)	1E-130	2-366	3-366	471	53	366	ref|WP_020154687.1|	GTP-binding protein YchF [Caldibacillus debilis]
555079	Thermosediminibacter oceani DSM 16646	1 (0.03%)	1E-130	2-366	1-364	470	53	366	ref|YP_003825030.1|	GTP-binding protein YchF [Thermosediminibacter oceani DSM 16...
1191699	Bacillus sp. ZYK	1 (0.03%)	1E-130	2-366	3-366	469	53	366	ref|WP_017756742.1|	GTP-binding protein YchF [Bacillus sp. ZYK]
81947	Vagococcus lutrae	1 (0.03%)	1E-129	2-366	3-366	468	53	366	ref|WP_023606894.1|	GTP-dependent nucleic acid-binding protein engD [Vagococcus ...
1288971	Clostridium ultunense Esp	1 (0.03%)	1E-129	3-366	5-367	468	53	365	ref|WP_005586614.1|	putative GTPase with RNA binding site [Clostridium ultunense...
986075	Caldalkalibacillus thermarum TA2.A1	1 (0.03%)	1E-129	1-366	1-365	467	53	367	ref|WP_007503329.1|	GTP-binding protein YchF [Caldalkalibacillus thermarum] gb|E...
1285586	Lysinibacillus sphaericus OT4b.31	1 (0.03%)	1E-129	2-366	3-366	466	53	366	ref|WP_010860725.1|	GTP-dependent nucleic acid-binding protein [Lysinibacillus s...
388400	Bacillus sp. B14905	1 (0.03%)	1E-128	2-366	3-366	466	53	366	ref|WP_008177960.1|	GTP-binding protein YchF [Bacillus sp. B14905] gb|EAZ85358.1...