| Features and Secondary Structure |
| | 1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280 . 290 . 300 . 310 . 320 . 330 . 340 . 350 . 360 |
| | MLSAGIVGLPNVGKSTLFSAITNLQVEIANYPFATIEPNTGIVNVSDERLDKLASLINPEKIVYTTFRFVDIAGLVKGASQGQGLGNQFLANIREVDLICHVVRCFQDKKIVHVNNTIDPVFDFEIIVNELIQADFELITNRIGKLKRKAESGDKIAKEEFVLLEIVLNGLKQGQMPIQTLSESELKTIKSLNLLTAKPILIVANVSENDLLNLDNNEALKKLNAFLDQKKIPKAITVCSLIEKELSGLKLEQRQYFLDELGLKNYSGLNRVIQAAYQTLNLWSFFTFGKKEVRAWTFKKGWNAPQCAGQIHSDFEKGFIKVEVISWDQLFAMKSLQEAKKQGLIRLEGKNYLIKDGDVCNFKFNVT |
| tmhmm (0) | ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| low complexity (5%) | ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXXXXXXXXXXX---------------------------------------------------------------------------------------------------------------------------------------------- |
| coiled-coils (0%) | ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| disordered (6%) | X---------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXXXXXXXXX------------------XXXXX------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ |
| psipred | --EEEEE------HHHHHHHHH----------------EEEEEE-----HHHHHHHH--------EEEEEE------HHH-----HHHHHHHHHHH-EEEEEEEE--------------HHHHHHHHHH------HHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHHH----EEE----HHH---HHHHHHHHHHHHHHH------EEEEHHHHHHHHH----HHHHHHHHHH-------HHHHHHHHHHH--EEEEE---------EE------HHHHHHHHHHHHHHH-EEEEE--HHHHHH---HHHHHH----------EEE----EEEEEEE-- |
PSI-BLAST Sequence Hits (Top 20 by Identity) ALL DATA
|
| TaxID |
Species |
Alignments |
PSI-Blast Data (alignment with lowest E value) |
| E value |
Query Span |
Sbjct Span |
Bit Score |
Identity |
HSP Length |
Accession |
Description |
| 1238993 | Mycoplasma pneumoniae M129-B7 | 1 (0.03%) | 1E-114 | 1-366 | 1-366 | 417 | 75 | 366 | ref|YP_005175258.1| | GTP-binding protein YchF [Mycoplasma pneumoniae 309] ref|YP_... |
| 340047 | Mycoplasma capricolum subsp. capricolum ATCC 27343 | 1 (0.03%) | 2E-50 | 2-174 | 3-175 | 206 | 62 | 173 | emb|CAA83699.1| | similar to GTP-bind. GTP1/OBG family [Mycoplasma capricolum ... |
| 443342 | candidate division TM7 genomosp. GTL1 | 2 (0.05%) | 8E-46 | 2-158 | 3-159 | 190 | 59 | 157 | ref|WP_008578825.1| | GTP-binding protein [candidate division TM7 genomosp. GTL1] ... |
| 626096 | Ureaplasma urealyticum serovar 2 str. ATCC 27814 | 1 (0.03%) | 1E-113 | 2-367 | 3-367 | 414 | 57 | 367 | ref|YP_002285050.1| | GTP-dependent nucleic acid-binding protein EngD [Ureaplasma ... |
| 910310 | Turicibacter sp. HGF1 | 1 (0.03%) | 1E-123 | 2-366 | 3-366 | 446 | 55 | 366 | ref|WP_006784579.1| | GTP-binding protein YchF [Turicibacter] gb|EFF63798.1| GTP-b... |
| 862259 | Mycoplasma mycoides subsp. capri LC str. 95010 | 1 (0.03%) | 1E-118 | 2-366 | 3-364 | 432 | 55 | 366 | ref|YP_004400584.1| | GTP binding protein [Mycoplasma mycoides subsp. capri LC str... |
| 1188246 | Mycoplasma mycoides subsp. capri PG3 | 1 (0.03%) | 1E-118 | 2-366 | 3-364 | 432 | 55 | 366 | ref|WP_017698114.1| | GTP-binding protein YchF [Mycoplasma mycoides] gb|ACU78419.1... |
| 94136 | Alkalibacillus haloalkaliphilus | 1 (0.03%) | 1E-129 | 2-366 | 3-366 | 467 | 54 | 366 | ref|WP_017185417.1| | GTP-binding protein YchF [Alkalibacillus haloalkaliphilus] |
| 51173 | Ureibacillus thermosphaericus | 1 (0.03%) | 1E-127 | 2-366 | 3-366 | 460 | 54 | 366 | ref|WP_016838918.1| | GTP-binding protein YchF [Ureibacillus thermosphaericus] |
| 1321820 | Gemella bergeriae ATCC 700627 | 1 (0.03%) | 1E-124 | 2-366 | 3-366 | 453 | 54 | 366 | ref|WP_021752543.1| | GTP-binding protein YchF [Gemella bergeri] gb|ERK56721.1| GT... |
| 156578 | Alteromonadales bacterium TW-7 | 2 (0.05%) | 4E-37 | 280-366 | 1-87 | 162 | 54 | 87 | ref|WP_006793419.1| | GTP-dependent nucleic acid-binding protein engD, partial [Al... |
| 521098 | Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 | 1 (0.03%) | 1E-130 | 2-366 | 3-366 | 472 | 53 | 366 | ref|YP_003186323.1| | GTP-binding protein YchF [Alicyclobacillus acidocaldarius su... |
| 301148 | Caldibacillus debilis | 1 (0.03%) | 1E-130 | 2-366 | 3-366 | 471 | 53 | 366 | ref|WP_020154687.1| | GTP-binding protein YchF [Caldibacillus debilis] |
| 555079 | Thermosediminibacter oceani DSM 16646 | 1 (0.03%) | 1E-130 | 2-366 | 1-364 | 470 | 53 | 366 | ref|YP_003825030.1| | GTP-binding protein YchF [Thermosediminibacter oceani DSM 16... |
| 1191699 | Bacillus sp. ZYK | 1 (0.03%) | 1E-130 | 2-366 | 3-366 | 469 | 53 | 366 | ref|WP_017756742.1| | GTP-binding protein YchF [Bacillus sp. ZYK] |
| 81947 | Vagococcus lutrae | 1 (0.03%) | 1E-129 | 2-366 | 3-366 | 468 | 53 | 366 | ref|WP_023606894.1| | GTP-dependent nucleic acid-binding protein engD [Vagococcus ... |
| 1288971 | Clostridium ultunense Esp | 1 (0.03%) | 1E-129 | 3-366 | 5-367 | 468 | 53 | 365 | ref|WP_005586614.1| | putative GTPase with RNA binding site [Clostridium ultunense... |
| 986075 | Caldalkalibacillus thermarum TA2.A1 | 1 (0.03%) | 1E-129 | 1-366 | 1-365 | 467 | 53 | 367 | ref|WP_007503329.1| | GTP-binding protein YchF [Caldalkalibacillus thermarum] gb|E... |
| 1285586 | Lysinibacillus sphaericus OT4b.31 | 1 (0.03%) | 1E-129 | 2-366 | 3-366 | 466 | 53 | 366 | ref|WP_010860725.1| | GTP-dependent nucleic acid-binding protein [Lysinibacillus s... |
| 388400 | Bacillus sp. B14905 | 1 (0.03%) | 1E-128 | 2-366 | 3-366 | 466 | 53 | 366 | ref|WP_008177960.1| | GTP-binding protein YchF [Bacillus sp. B14905] gb|EAZ85358.1... |