old.robetta.org

A new Robetta server is available for structure prediction.

This service will be discontinued at the end of April 2026

     
Fragment Libraries    Alanine Scanning    DNA Interface Scan
[ Queue ] [ Submit ]    [ Queue ] [ Submit ]    [ Queue ] [ Submit ]
[ Register / Update ] [ Docs / FAQs ] [ Login ]


     
Job 88287 [SSGCID - MygeA.17482.a] [2019-01-18] [D-172-16-30-137.dhcp4.x.x] [Structure] [Complete] Ribosome-binding ATPase YchF (MG_024) - BATCH:88256

Full Structure Predictions  
Model 1

 chemical/x-pdb  MIME type  PDB file
Model 2

 chemical/x-pdb  MIME type  PDB file
Model 3

 chemical/x-pdb  MIME type  PDB file
Model 4

 chemical/x-pdb  MIME type  PDB file
Model 5

 chemical/x-pdb  MIME type  PDB file

Click the icons below each image to download the prediction in PDB format ( PDB file )

Images were produced using MolScript and Raster3D!




Plots powered by Plotly.js.

Features and Secondary Structure  
 
1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    
 
MLSAGIVGLPNVGKSTLFSAITNLQVEIANYPFATIEPNTGIVNVSDERLDKLASLINPEKIVYTTFRFVDIAGLVKGASQGQGLGNQFLANIREVDLICHVVRCFQDKKIVHVNNTIDPVFDFEIIVNELIQADFELITNRIGKLKRKAESGDKIAKEEFVLLEIVLNGLKQGQMPIQTLSESELKTIKSLNLLTAKPILIVANVSENDLLNLDNNEALKKLNAFLDQKKIPKAITVCSLIEKELSGLKLEQRQYFLDELGLKNYSGLNRVIQAAYQTLNLWSFFTFGKKEVRAWTFKKGWNAPQCAGQIHSDFEKGFIKVEVISWDQLFAMKSLQEAKKQGLIRLEGKNYLIKDGDVCNFKFNVT
tmhmm (0)
-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (5%)
---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXXXXXXXXXXX----------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)
-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (6%)
X---------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXXXXXXXXX------------------XXXXX------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
psipred
--EEEEE------HHHHHHHHH----------------EEEEEE-----HHHHHHHH--------EEEEEE------HHH-----HHHHHHHHHHH-EEEEEEEE--------------HHHHHHHHHH------HHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHHH----EEE----HHH---HHHHHHHHHHHHHHH------EEEEHHHHHHHHH----HHHHHHHHHH-------HHHHHHHHHHH--EEEEE---------EE------HHHHHHHHHHHHHHH-EEEEE--HHHHHH---HHHHHH----------EEE----EEEEEEE--

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    35	    0.223
  max. Y    35	    0.249
  max. S    14	    0.415
  mean S     1-34   0.307
       D     1-34   0.272    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.272 D-cutoff=0.450 Networks=SignalP-TM


Domain Repeats Prediction     Top
  Boundary     STD (+/-)     Consensus  
------


Ginzu Domain Prediction 1       Top
Domain Span Source Reference Parent   Parent Span     Confidence     Annotations  
  1-367     alignment     1jalA_202     1-348   0.9040   STRUCTURAL GENOMICS, UNKNOWN FUNCTION


PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA       Top
TaxID Species Alignments PSI-Blast Data (alignment with lowest E value)
E value Query Span Sbjct Span Bit Score Identity HSP Length Accession Description
1238993Mycoplasma pneumoniae M129-B71 (0.03%)1E-1141-3661-36641775366ref|YP_005175258.1|GTP-binding protein YchF [Mycoplasma pneumoniae 309] ref|YP_...
340047Mycoplasma capricolum subsp. capricolum ATCC 273431 (0.03%)2E-502-1743-17520662173emb|CAA83699.1|similar to GTP-bind. GTP1/OBG family [Mycoplasma capricolum ...
443342candidate division TM7 genomosp. GTL12 (0.05%)8E-462-1583-15919059157ref|WP_008578825.1|GTP-binding protein [candidate division TM7 genomosp. GTL1] ...
626096Ureaplasma urealyticum serovar 2 str. ATCC 278141 (0.03%)1E-1132-3673-36741457367ref|YP_002285050.1|GTP-dependent nucleic acid-binding protein EngD [Ureaplasma ...
910310Turicibacter sp. HGF11 (0.03%)1E-1232-3663-36644655366ref|WP_006784579.1|GTP-binding protein YchF [Turicibacter] gb|EFF63798.1| GTP-b...
862259Mycoplasma mycoides subsp. capri LC str. 950101 (0.03%)1E-1182-3663-36443255366ref|YP_004400584.1|GTP binding protein [Mycoplasma mycoides subsp. capri LC str...
1188246Mycoplasma mycoides subsp. capri PG31 (0.03%)1E-1182-3663-36443255366ref|WP_017698114.1|GTP-binding protein YchF [Mycoplasma mycoides] gb|ACU78419.1...
94136Alkalibacillus haloalkaliphilus1 (0.03%)1E-1292-3663-36646754366ref|WP_017185417.1|GTP-binding protein YchF [Alkalibacillus haloalkaliphilus]
51173Ureibacillus thermosphaericus1 (0.03%)1E-1272-3663-36646054366ref|WP_016838918.1|GTP-binding protein YchF [Ureibacillus thermosphaericus]
1321820Gemella bergeriae ATCC 7006271 (0.03%)1E-1242-3663-36645354366ref|WP_021752543.1|GTP-binding protein YchF [Gemella bergeri] gb|ERK56721.1| GT...
156578Alteromonadales bacterium TW-72 (0.05%)4E-37280-3661-871625487ref|WP_006793419.1|GTP-dependent nucleic acid-binding protein engD, partial [Al...
521098Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 4461 (0.03%)1E-1302-3663-36647253366ref|YP_003186323.1|GTP-binding protein YchF [Alicyclobacillus acidocaldarius su...
301148Caldibacillus debilis1 (0.03%)1E-1302-3663-36647153366ref|WP_020154687.1|GTP-binding protein YchF [Caldibacillus debilis]
555079Thermosediminibacter oceani DSM 166461 (0.03%)1E-1302-3661-36447053366ref|YP_003825030.1|GTP-binding protein YchF [Thermosediminibacter oceani DSM 16...
1191699Bacillus sp. ZYK1 (0.03%)1E-1302-3663-36646953366ref|WP_017756742.1|GTP-binding protein YchF [Bacillus sp. ZYK]
81947Vagococcus lutrae1 (0.03%)1E-1292-3663-36646853366ref|WP_023606894.1|GTP-dependent nucleic acid-binding protein engD [Vagococcus ...
1288971Clostridium ultunense Esp1 (0.03%)1E-1293-3665-36746853365ref|WP_005586614.1|putative GTPase with RNA binding site [Clostridium ultunense...
986075Caldalkalibacillus thermarum TA2.A11 (0.03%)1E-1291-3661-36546753367ref|WP_007503329.1|GTP-binding protein YchF [Caldalkalibacillus thermarum] gb|E...
1285586Lysinibacillus sphaericus OT4b.311 (0.03%)1E-1292-3663-36646653366ref|WP_010860725.1|GTP-dependent nucleic acid-binding protein [Lysinibacillus s...
388400Bacillus sp. B149051 (0.03%)1E-1282-3663-36646653366ref|WP_008177960.1|GTP-binding protein YchF [Bacillus sp. B14905] gb|EAZ85358.1...






Robetta is available for NON-COMMERCIAL USE ONLY at this time
[ Terms of Service ]
Copyright © 2004-2011 University of Washington