old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280
	MSDTNTEKPELVSLNKLSEMRTNIGMVKRYWNPKMGFFIEPERKHNNDLLKLDLQYQALKTAYNFIKDVVKNHGQILFVGTKNDYVKKLVIDIAKRVNVAYITQRWLGGTLTNFKTLSISINKLNKLVEQQKQNANDLTKKENLLLSREIERLEKFFGGVKNLKRLPNLIVIDDPVYEKNAVLEANSLKIPVVALCNTNTNPELVDFIIPANNHQPQSTCLLMNLLADAIAEAKGFETLYAYKPDEQIQIEIPPKQERQVINRSNTRNITNQRLNINRQQQETL
tmhmm (0)	--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)	--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (7%)	------------------------------------------------------------------------------------------------------------------------XXXXXXXXXXXXXXXXXXXXX-----------------------------------------------------------------------------------------------------------------------------------------------
disordered (21%)	XXXXXXXXXX-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
psipred	-------------HHHHHHH------------HHHHHHH-------EEEE-HHHHHHHHHHHHHHHHHHHH---EEEEEE---HHHHHHHHHHHHHH----------------HHHHH-HHHHHHHHHHHH--------HHHHHHHHHHHHHHHHHH-----------EEEEE--HH-HHHHHHHHH----EEEEEE---------EE--------HHHHHHHHHHHHHHHHH----HHHH----HHHH-----HHHHHHH-----------------------

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    30	    0.123
  max. Y     3	    0.135
  max. S     2	    0.217
  mean S     1-2    0.195
       D     1-2    0.158    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.158 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-284	alignment	4toiA_301	1-307	0.7711	--

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
1212764	Paenibacillus popilliae ATCC 14706	1 (0.03%)	5E-93	9-241	1-232	347	41	234	ref|WP_006286750.1|	30S ribosomal protein S2 [Paenibacillus popilliae] dbj|GAC43...
459527	Saccharibacillus kuerlensis	1 (0.03%)	8E-93	9-241	1-232	346	41	234	ref|WP_018975001.1|	30S ribosomal protein S2 [Saccharibacillus kuerlensis]
796606	Bacillus methanolicus MGA3	1 (0.03%)	4E-92	9-236	1-227	344	41	229	ref|WP_003349088.1|	30S ribosomal protein S2 [Bacillus methanolicus] gb|EIJ79609...
380174	Cohnella laeviribosi	1 (0.03%)	4E-92	9-241	1-232	344	41	234	ref|WP_019003789.1|	30S ribosomal protein S2 [Cohnella laeviribosi]
379896	Paenibacillus fonticola	1 (0.03%)	6E-92	9-241	1-232	343	41	234	ref|WP_019638048.1|	30S ribosomal protein S2 [Paenibacillus fonticola]
225906	Paenibacillus sanguinis	1 (0.03%)	1E-91	9-241	1-232	343	41	234	ref|WP_018750945.1|	30S ribosomal protein S2 [Paenibacillus sanguinis]
1227351	Paenibacillus sp. FSL H8-457	1 (0.03%)	1E-91	9-241	1-232	342	41	234	ref|YP_003244191.1|	30S ribosomal protein S2 [Paenibacillus sp. Y412MC10] ref|WP...
1227076	Paenibacillus sp. FSL R5-808	1 (0.03%)	1E-91	9-241	1-232	342	41	234	gb|ETT34544.1|	30S ribosomal protein S2 [Paenibacillus sp. FSL R5-808]
1274524	Bacillus sonorensis L12	1 (0.03%)	4E-91	9-236	1-227	341	41	229	ref|WP_006638147.1|	30S ribosomal protein S2 [Bacillus sonorensis] gb|EME74267.1...
1302650	Bacillus subtilis subsp. subtilis str. BAB-1	1 (0.03%)	3E-91	9-236	1-227	341	41	229	ref|NP_389531.1|	30S ribosomal protein S2 [Bacillus subtilis subsp. subtilis ...
445972	Anaerotruncus colihominis DSM 17241	1 (0.03%)	5E-91	9-236	1-227	340	41	229	ref|WP_006875232.1|	30S ribosomal protein S2 [Anaerotruncus colihominis] gb|EDS1...
1126218	Bacillus licheniformis WX-02	1 (0.03%)	1E-90	9-236	1-227	339	41	229	ref|YP_079043.1|	30S ribosomal protein S2 [Bacillus licheniformis DSM 13 = AT...
1202457	Bacillus sp. CPSM8	1 (0.03%)	1E-90	9-236	1-227	339	41	229	ref|YP_008078009.1|	30S ribosomal protein S2 [Bacillus licheniformis 9945A] ref|...
742743	Dialister succinatiphilus YIT 11850	1 (0.03%)	2E-90	9-238	1-229	339	41	231	ref|WP_008859226.1|	30S ribosomal protein S2 [Dialister succinatiphilus] gb|EHO6...
1262878	Eubacterium sp. CAG:115	1 (0.03%)	9E-90	9-236	1-227	336	41	229	ref|WP_021956579.1|	30S ribosomal protein S2 [Eubacterium sp. CAG:115] emb|CCY73...
717961	Eubacterium siraeum V10Sc8a	1 (0.03%)	1E-89	9-239	1-230	336	41	232	ref|YP_007840554.1|	SSU ribosomal protein S2P [Eubacterium siraeum V10Sc8a] ref|...
657319	Eubacterium siraeum 70/3	1 (0.03%)	1E-89	9-239	1-230	335	41	232	ref|YP_007774964.1|	SSU ribosomal protein S2P [Eubacterium siraeum 70/3] ref|WP_...
387092	Nitratiruptor sp. SB155-2	1 (0.03%)	3E-85	11-234	1-223	321	41	225	ref|YP_001357001.1|	30S ribosomal protein S2 [Nitratiruptor sp. SB155-2] ref|WP_...
3888	Pisum sativum	1 (0.03%)	2E-11	190-235	1-46	77	41	46	emb|CAA29348.1|	rps2 [Pisum sativum]
986075	Caldalkalibacillus thermarum TA2.A1	1 (0.03%)	3E-95	9-241	1-232	354	40	234	ref|WP_007503194.1|	30S ribosomal protein S2 [Caldalkalibacillus thermarum] gb|E...