old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 .
	MLQPKRTKYRKPHNVSYEGHTKGNGYVAFGEYGIVATKGNWIDARAIESARVAISKCLGKTGKMWIRIFPHMSKTKKPLEVRMGSGKGNPEFWVAVVKKGTVMFEVANIPEQQMIKALTRAGHKLPVTWKLMKREENS
tmhmm (0)	------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)	------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	------------------------------------------------------------------------------------------------------------------------------------------
disordered (24%)	XXX----XXXXXXXXXXXXXXXXXX---------------------------------------------------XXXXXXXXX--------------------------------------------------XXX
psipred	-------------------------EEEE----EEEEE--EE-HHHHHHHHHHHHHHHHH---EEEEEE----EEE-HHH-EE--------EEEEEE---EEEEEE----HHHHHHHHHHHHHH----EEEEEE----

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    47	    0.133
  max. Y     2	    0.191
  max. S     1	    0.373
  mean S     1-1    0.373
       D     1-1    0.262    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.262 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-138	alignment	4wceJ_202	1-141	0.8019	--

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
626096	Ureaplasma urealyticum serovar 2 str. ATCC 27814	1 (0.03%)	7E-44	1-138	1-138	182	71	138	ref|YP_002284637.1|	50S ribosomal protein L16 [Ureaplasma urealyticum serovar 10...
866629	Mycoplasma leachii 99/014/6	1 (0.03%)	9E-46	1-137	1-137	188	63	137	ref|YP_004047441.1|	50S ribosomal protein L16 [Mycoplasma leachii PG50] ref|YP_0...
451640	Catenibacterium mitsuokai DSM 15897	1 (0.03%)	3E-45	1-136	1-136	186	63	136	ref|WP_006505630.1|	50S ribosomal protein L16 [Catenibacterium] gb|EEF93892.1| r...
1033810	Haloplasma contractile SSD-17B	1 (0.03%)	5E-49	1-136	1-136	199	62	136	ref|WP_008825042.1|	50S ribosomal protein L16 [Haloplasma contractile] gb|ERJ123...
469597	Coprobacillus sp. 8_2_54BFAA	1 (0.03%)	5E-49	1-136	1-136	199	61	136	ref|WP_003536819.1|	50S ribosomal protein L16 [Erysipelotrichaceae] gb|EDS18490....
469596	Coprobacillus sp. 29_1	1 (0.03%)	3E-48	1-136	1-136	196	60	136	ref|WP_008790812.1|	50S ribosomal protein L16 [Coprobacillus] gb|EFW03083.1| 50S...
428126	Clostridium spiroforme DSM 1552	1 (0.03%)	1E-46	3-136	1-134	191	60	134	ref|WP_004610079.1|	50S ribosomal protein L16 [[Clostridium] spiroforme] gb|EDS7...
428127	Eubacterium dolichum DSM 3991	1 (0.03%)	3E-46	1-135	1-135	190	60	135	ref|WP_004798256.1|	50S ribosomal protein L16 [Firmicutes] gb|EDP11999.1| riboso...
670487	Oceanithermus profundus DSM 14977	1 (0.03%)	2E-49	1-135	1-135	200	59	135	ref|YP_004058247.1|	50S ribosomal protein L16 [Oceanithermus profundus DSM 14977...
650150	Erysipelothrix rhusiopathiae str. Fujisawa	1 (0.03%)	2E-47	1-137	1-137	193	59	137	ref|YP_004561261.1|	50S ribosomal protein L16 [Erysipelothrix rhusiopathiae str....
1292033	Mycoplasma putrefaciens Mput9231	1 (0.03%)	4E-46	1-137	1-137	189	59	137	ref|YP_004790048.1|	50S ribosomal protein L16 [Mycoplasma putrefaciens KS1] ref|...
94136	Alkalibacillus haloalkaliphilus	1 (0.03%)	2E-52	1-136	1-136	210	58	136	ref|WP_017185234.1|	50S ribosomal protein L16 [Alkalibacillus haloalkaliphilus]
910310	Turicibacter sp. HGF1	1 (0.03%)	9E-50	1-137	1-137	201	58	137	ref|WP_006784437.1|	50S ribosomal protein L16 [Turicibacter] gb|EFF63978.1| ribo...
999413	Clostridium innocuum 2959	1 (0.03%)	8E-47	1-137	1-137	191	58	137	ref|WP_002607423.1|	50S ribosomal protein L16 [Firmicutes] gb|EFP60786.1| riboso...
665959	Bacillus sp. 2_A_57_CT2	1 (0.03%)	2E-53	1-136	1-136	214	57	136	ref|WP_009336587.1|	50S ribosomal protein L16 [Bacillus] gb|EFV74201.1| 50S ribo...
986075	Caldalkalibacillus thermarum TA2.A1	1 (0.03%)	3E-53	1-135	1-135	213	57	135	ref|WP_007505920.1|	50S ribosomal protein L16 [Caldalkalibacillus thermarum] gb|...
977905	Bacillus sp. 17376	1 (0.03%)	3E-53	1-136	1-136	213	57	136	ref|WP_023626423.1|	50S ribosomal protein L16 [Bacillus sp. 17376] gb|ESU31471.1...
408580	Bacillus coahuilensis	1 (0.03%)	6E-53	1-136	1-136	212	57	136	ref|WP_010169932.1|	50S ribosomal protein L16 [Bacillus coahuilensis]
1132442	Bacillus sp. 37MA	1 (0.03%)	1E-52	1-136	1-136	211	57	136	ref|WP_018395162.1|	50S ribosomal protein L16 [Bacillus sp. 37MA]
1087448	Exiguobacterium antarcticum B7	1 (0.03%)	1E-52	1-137	1-137	211	57	137	ref|YP_001812607.1|	50S ribosomal protein L16 [Exiguobacterium sibiricum 255-15]...