old.robetta.org

A new Robetta server is available for structure prediction.

This service will be discontinued at the end of April 2026

     
Fragment Libraries    Alanine Scanning    DNA Interface Scan
[ Queue ] [ Submit ]    [ Queue ] [ Submit ]    [ Queue ] [ Submit ]
[ Register / Update ] [ Docs / FAQs ] [ Login ]


     
Job 88290 [SSGCID - MygeA.17916.a] [2019-01-18] [D-172-16-30-137.dhcp4.x.x] [Structure] [Complete] 50S ribosomal protein L16 (MG_158) - BATCH:88256

Full Structure Predictions  
Model 1

 chemical/x-pdb  MIME type  PDB file
Model 2

 chemical/x-pdb  MIME type  PDB file
Model 3

 chemical/x-pdb  MIME type  PDB file
Model 4

 chemical/x-pdb  MIME type  PDB file
Model 5

 chemical/x-pdb  MIME type  PDB file

Click the icons below each image to download the prediction in PDB format ( PDB file )

Images were produced using MolScript and Raster3D!




Plots powered by Plotly.js.

Features and Secondary Structure  
 
1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
 
MLQPKRTKYRKPHNVSYEGHTKGNGYVAFGEYGIVATKGNWIDARAIESARVAISKCLGKTGKMWIRIFPHMSKTKKPLEVRMGSGKGNPEFWVAVVKKGTVMFEVANIPEQQMIKALTRAGHKLPVTWKLMKREENS
tmhmm (0)
------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)
------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)
------------------------------------------------------------------------------------------------------------------------------------------
disordered (24%)
XXX----XXXXXXXXXXXXXXXXXX---------------------------------------------------XXXXXXXXX--------------------------------------------------XXX
psipred
-------------------------EEEE----EEEEE--EE-HHHHHHHHHHHHHHHHH---EEEEEE----EEE-HHH-EE--------EEEEEE---EEEEEE----HHHHHHHHHHHHHH----EEEEEE----

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    47	    0.133
  max. Y     2	    0.191
  max. S     1	    0.373
  mean S     1-1    0.373
       D     1-1    0.262    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.262 D-cutoff=0.450 Networks=SignalP-TM


Domain Repeats Prediction     Top
  Boundary     STD (+/-)     Consensus  
------


Ginzu Domain Prediction 1       Top
Domain Span Source Reference Parent   Parent Span     Confidence     Annotations  
  1-138     alignment     4wceJ_202     1-141   0.8019   --


PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA       Top
TaxID Species Alignments PSI-Blast Data (alignment with lowest E value)
E value Query Span Sbjct Span Bit Score Identity HSP Length Accession Description
626096Ureaplasma urealyticum serovar 2 str. ATCC 278141 (0.03%)7E-441-1381-13818271138ref|YP_002284637.1|50S ribosomal protein L16 [Ureaplasma urealyticum serovar 10...
866629Mycoplasma leachii 99/014/61 (0.03%)9E-461-1371-13718863137ref|YP_004047441.1|50S ribosomal protein L16 [Mycoplasma leachii PG50] ref|YP_0...
451640Catenibacterium mitsuokai DSM 158971 (0.03%)3E-451-1361-13618663136ref|WP_006505630.1|50S ribosomal protein L16 [Catenibacterium] gb|EEF93892.1| r...
1033810Haloplasma contractile SSD-17B1 (0.03%)5E-491-1361-13619962136ref|WP_008825042.1|50S ribosomal protein L16 [Haloplasma contractile] gb|ERJ123...
469597Coprobacillus sp. 8_2_54BFAA1 (0.03%)5E-491-1361-13619961136ref|WP_003536819.1|50S ribosomal protein L16 [Erysipelotrichaceae] gb|EDS18490....
469596Coprobacillus sp. 29_11 (0.03%)3E-481-1361-13619660136ref|WP_008790812.1|50S ribosomal protein L16 [Coprobacillus] gb|EFW03083.1| 50S...
428126Clostridium spiroforme DSM 15521 (0.03%)1E-463-1361-13419160134ref|WP_004610079.1|50S ribosomal protein L16 [[Clostridium] spiroforme] gb|EDS7...
428127Eubacterium dolichum DSM 39911 (0.03%)3E-461-1351-13519060135ref|WP_004798256.1|50S ribosomal protein L16 [Firmicutes] gb|EDP11999.1| riboso...
670487Oceanithermus profundus DSM 149771 (0.03%)2E-491-1351-13520059135ref|YP_004058247.1|50S ribosomal protein L16 [Oceanithermus profundus DSM 14977...
650150Erysipelothrix rhusiopathiae str. Fujisawa1 (0.03%)2E-471-1371-13719359137ref|YP_004561261.1|50S ribosomal protein L16 [Erysipelothrix rhusiopathiae str....
1292033Mycoplasma putrefaciens Mput92311 (0.03%)4E-461-1371-13718959137ref|YP_004790048.1|50S ribosomal protein L16 [Mycoplasma putrefaciens KS1] ref|...
94136Alkalibacillus haloalkaliphilus1 (0.03%)2E-521-1361-13621058136ref|WP_017185234.1|50S ribosomal protein L16 [Alkalibacillus haloalkaliphilus]
910310Turicibacter sp. HGF11 (0.03%)9E-501-1371-13720158137ref|WP_006784437.1|50S ribosomal protein L16 [Turicibacter] gb|EFF63978.1| ribo...
999413Clostridium innocuum 29591 (0.03%)8E-471-1371-13719158137ref|WP_002607423.1|50S ribosomal protein L16 [Firmicutes] gb|EFP60786.1| riboso...
665959Bacillus sp. 2_A_57_CT21 (0.03%)2E-531-1361-13621457136ref|WP_009336587.1|50S ribosomal protein L16 [Bacillus] gb|EFV74201.1| 50S ribo...
986075Caldalkalibacillus thermarum TA2.A11 (0.03%)3E-531-1351-13521357135ref|WP_007505920.1|50S ribosomal protein L16 [Caldalkalibacillus thermarum] gb|...
977905Bacillus sp. 173761 (0.03%)3E-531-1361-13621357136ref|WP_023626423.1|50S ribosomal protein L16 [Bacillus sp. 17376] gb|ESU31471.1...
408580Bacillus coahuilensis1 (0.03%)6E-531-1361-13621257136ref|WP_010169932.1|50S ribosomal protein L16 [Bacillus coahuilensis]
1132442Bacillus sp. 37MA1 (0.03%)1E-521-1361-13621157136ref|WP_018395162.1|50S ribosomal protein L16 [Bacillus sp. 37MA]
1087448Exiguobacterium antarcticum B71 (0.03%)1E-521-1371-13721157137ref|YP_001812607.1|50S ribosomal protein L16 [Exiguobacterium sibiricum 255-15]...






Robetta is available for NON-COMMERCIAL USE ONLY at this time
[ Terms of Service ]
Copyright © 2004-2011 University of Washington