| Features and Secondary Structure |
| | 1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . |
| | MLQPKRTKYRKPHNVSYEGHTKGNGYVAFGEYGIVATKGNWIDARAIESARVAISKCLGKTGKMWIRIFPHMSKTKKPLEVRMGSGKGNPEFWVAVVKKGTVMFEVANIPEQQMIKALTRAGHKLPVTWKLMKREENS |
| tmhmm (0) | ------------------------------------------------------------------------------------------------------------------------------------------ |
| low complexity (0%) | ------------------------------------------------------------------------------------------------------------------------------------------ |
| coiled-coils (0%) | ------------------------------------------------------------------------------------------------------------------------------------------ |
| disordered (24%) | XXX----XXXXXXXXXXXXXXXXXX---------------------------------------------------XXXXXXXXX--------------------------------------------------XXX |
| psipred | -------------------------EEEE----EEEEE--EE-HHHHHHHHHHHHHHHHH---EEEEEE----EEE-HHH-EE--------EEEEEE---EEEEEE----HHHHHHHHHHHHHH----EEEEEE---- |
PSI-BLAST Sequence Hits (Top 20 by Identity) ALL DATA
|
| TaxID |
Species |
Alignments |
PSI-Blast Data (alignment with lowest E value) |
| E value |
Query Span |
Sbjct Span |
Bit Score |
Identity |
HSP Length |
Accession |
Description |
| 626096 | Ureaplasma urealyticum serovar 2 str. ATCC 27814 | 1 (0.03%) | 7E-44 | 1-138 | 1-138 | 182 | 71 | 138 | ref|YP_002284637.1| | 50S ribosomal protein L16 [Ureaplasma urealyticum serovar 10... |
| 866629 | Mycoplasma leachii 99/014/6 | 1 (0.03%) | 9E-46 | 1-137 | 1-137 | 188 | 63 | 137 | ref|YP_004047441.1| | 50S ribosomal protein L16 [Mycoplasma leachii PG50] ref|YP_0... |
| 451640 | Catenibacterium mitsuokai DSM 15897 | 1 (0.03%) | 3E-45 | 1-136 | 1-136 | 186 | 63 | 136 | ref|WP_006505630.1| | 50S ribosomal protein L16 [Catenibacterium] gb|EEF93892.1| r... |
| 1033810 | Haloplasma contractile SSD-17B | 1 (0.03%) | 5E-49 | 1-136 | 1-136 | 199 | 62 | 136 | ref|WP_008825042.1| | 50S ribosomal protein L16 [Haloplasma contractile] gb|ERJ123... |
| 469597 | Coprobacillus sp. 8_2_54BFAA | 1 (0.03%) | 5E-49 | 1-136 | 1-136 | 199 | 61 | 136 | ref|WP_003536819.1| | 50S ribosomal protein L16 [Erysipelotrichaceae] gb|EDS18490.... |
| 469596 | Coprobacillus sp. 29_1 | 1 (0.03%) | 3E-48 | 1-136 | 1-136 | 196 | 60 | 136 | ref|WP_008790812.1| | 50S ribosomal protein L16 [Coprobacillus] gb|EFW03083.1| 50S... |
| 428126 | Clostridium spiroforme DSM 1552 | 1 (0.03%) | 1E-46 | 3-136 | 1-134 | 191 | 60 | 134 | ref|WP_004610079.1| | 50S ribosomal protein L16 [[Clostridium] spiroforme] gb|EDS7... |
| 428127 | Eubacterium dolichum DSM 3991 | 1 (0.03%) | 3E-46 | 1-135 | 1-135 | 190 | 60 | 135 | ref|WP_004798256.1| | 50S ribosomal protein L16 [Firmicutes] gb|EDP11999.1| riboso... |
| 670487 | Oceanithermus profundus DSM 14977 | 1 (0.03%) | 2E-49 | 1-135 | 1-135 | 200 | 59 | 135 | ref|YP_004058247.1| | 50S ribosomal protein L16 [Oceanithermus profundus DSM 14977... |
| 650150 | Erysipelothrix rhusiopathiae str. Fujisawa | 1 (0.03%) | 2E-47 | 1-137 | 1-137 | 193 | 59 | 137 | ref|YP_004561261.1| | 50S ribosomal protein L16 [Erysipelothrix rhusiopathiae str.... |
| 1292033 | Mycoplasma putrefaciens Mput9231 | 1 (0.03%) | 4E-46 | 1-137 | 1-137 | 189 | 59 | 137 | ref|YP_004790048.1| | 50S ribosomal protein L16 [Mycoplasma putrefaciens KS1] ref|... |
| 94136 | Alkalibacillus haloalkaliphilus | 1 (0.03%) | 2E-52 | 1-136 | 1-136 | 210 | 58 | 136 | ref|WP_017185234.1| | 50S ribosomal protein L16 [Alkalibacillus haloalkaliphilus] |
| 910310 | Turicibacter sp. HGF1 | 1 (0.03%) | 9E-50 | 1-137 | 1-137 | 201 | 58 | 137 | ref|WP_006784437.1| | 50S ribosomal protein L16 [Turicibacter] gb|EFF63978.1| ribo... |
| 999413 | Clostridium innocuum 2959 | 1 (0.03%) | 8E-47 | 1-137 | 1-137 | 191 | 58 | 137 | ref|WP_002607423.1| | 50S ribosomal protein L16 [Firmicutes] gb|EFP60786.1| riboso... |
| 665959 | Bacillus sp. 2_A_57_CT2 | 1 (0.03%) | 2E-53 | 1-136 | 1-136 | 214 | 57 | 136 | ref|WP_009336587.1| | 50S ribosomal protein L16 [Bacillus] gb|EFV74201.1| 50S ribo... |
| 986075 | Caldalkalibacillus thermarum TA2.A1 | 1 (0.03%) | 3E-53 | 1-135 | 1-135 | 213 | 57 | 135 | ref|WP_007505920.1| | 50S ribosomal protein L16 [Caldalkalibacillus thermarum] gb|... |
| 977905 | Bacillus sp. 17376 | 1 (0.03%) | 3E-53 | 1-136 | 1-136 | 213 | 57 | 136 | ref|WP_023626423.1| | 50S ribosomal protein L16 [Bacillus sp. 17376] gb|ESU31471.1... |
| 408580 | Bacillus coahuilensis | 1 (0.03%) | 6E-53 | 1-136 | 1-136 | 212 | 57 | 136 | ref|WP_010169932.1| | 50S ribosomal protein L16 [Bacillus coahuilensis] |
| 1132442 | Bacillus sp. 37MA | 1 (0.03%) | 1E-52 | 1-136 | 1-136 | 211 | 57 | 136 | ref|WP_018395162.1| | 50S ribosomal protein L16 [Bacillus sp. 37MA] |
| 1087448 | Exiguobacterium antarcticum B7 | 1 (0.03%) | 1E-52 | 1-137 | 1-137 | 211 | 57 | 137 | ref|YP_001812607.1| | 50S ribosomal protein L16 [Exiguobacterium sibiricum 255-15]... |