| Features and Secondary Structure |
| | 1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . |
| | MQAANDHFFTGLSKKGPVRKENQDFYGFSFNQNNLLIVVCDGLGGYKGGKIASNLVGKLFLSLFEGFEFNQWDETTVKKWFENTLIQARFQLENCFQTVYEAQIQFARMASTLVLGILTKSDIYIFWIGDSRAYLLFENQAKLVTKDHNLYNQLVAMNADEKLLLSYSNQLLALTNTISKETKRPLVYGFYNTKIEQQEFLLLCSDGLYNFVEKELFFEIITNSKNLKQAVFNLYRKSIENASNDNITAALVNLQKWKQS |
| tmhmm (0) | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| low complexity (5%) | ------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXXXXX-------------------------------------------------------------------------------------- |
| coiled-coils (0%) | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| disordered (4%) | XX-----------------------------------------------------------------------X---------------------------XXX----------------------------------------------------------------------------------------------------------------------------------------------------X---XXXX |
| psipred | ------EEEEEE--------------EE------EEEEEEE------HHHHHHHHHHHHHHHHHHHH------HHHHHHHHHHHHHHHHHHHHHHHHHHHHH---------EEEEEEEE--EEEEEE-----EEEEEEEEEEEEE----HHHHHHHHH----EEEE-----EEEEEE-----------EEEE------EEEEEE---------HHHHHHHHH----HHHHHHHHHHHHHH------EEEEEEEE------ |
PSI-BLAST Sequence Hits (Top 20 by Identity) ALL DATA
|
| TaxID |
Species |
Alignments |
PSI-Blast Data (alignment with lowest E value) |
| E value |
Query Span |
Sbjct Span |
Bit Score |
Identity |
HSP Length |
Accession |
Description |
| 662947 | Mycoplasma genitalium M2288 | 1 (0.03%) | 4E-63 | 1-260 | 1-260 | 247 | 100 | 260 | ref|NP_072770.1| | protein phosphatase 2C, [Mycoplasma genitalium G37] ref|YP_0... |
| 2097 | Mycoplasma genitalium | 1 (0.03%) | 1E-50 | 1-215 | 1-215 | 206 | 100 | 215 | ref|WP_009885666.1| | protein phosphatase [Mycoplasma genitalium] |
| 710128 | Mycoplasma gallisepticum str. R(high) | 1 (0.03%) | 4E-44 | 5-256 | 1-260 | 184 | 34 | 261 | ref|NP_853421.2| | PP2C-like serine/threonine protein phosphatase [Mycoplasma g... |
| 708616 | Mycoplasma gallisepticum str. F | 1 (0.03%) | 3E-44 | 5-256 | 1-260 | 184 | 34 | 261 | ref|YP_005880955.1| | PP2C-like serine/threonine protein phosphatase [Mycoplasma g... |
| 449659 | Lactobacillus pobuzihii | 1 (0.03%) | 3E-61 | 9-260 | 3-247 | 241 | 31 | 254 | ref|WP_017868032.1| | protein phosphatase [Lactobacillus pobuzihii] |
| 243272 | Mycoplasma arthritidis 158L3-1 | 1 (0.03%) | 6E-48 | 7-254 | 1-247 | 197 | 31 | 252 | ref|YP_002000181.1| | phosphoprotein serine/threonine phosphatase [Mycoplasma arth... |
| 626096 | Ureaplasma urealyticum serovar 2 str. ATCC 27814 | 1 (0.03%) | 3E-41 | 9-249 | 3-242 | 175 | 31 | 245 | ref|YP_002284613.1| | protein phosphatase [Ureaplasma urealyticum serovar 10 str. ... |
| 1398 | Bacillus coagulans | 2 (0.05%) | 4E-67 | 11-252 | 5-240 | 260 | 30 | 243 | ref|WP_017552947.1| | protein phosphatase [Bacillus coagulans] |
| 345219 | Bacillus coagulans 36D1 | 1 (0.03%) | 6E-67 | 11-252 | 5-240 | 260 | 30 | 243 | ref|YP_004858109.1| | Ser/Thr phosphatase [Bacillus coagulans 36D1] ref|WP_0140954... |
| 1053191 | Bacillus cereus BAG5X2-1 | 1 (0.03%) | 2E-65 | 12-254 | 6-242 | 255 | 30 | 244 | ref|WP_000648694.1| | protein phosphatase [Bacillus cereus] gb|EEK66379.1| Protein... |
| 1053176 | Bacillus cereus BAG2O-1 | 1 (0.03%) | 2E-65 | 12-254 | 6-242 | 255 | 30 | 244 | ref|WP_016080515.1| | protein phosphatase 2C [Bacillus cereus] gb|EOO29204.1| prot... |
| 529122 | Bacillus thuringiensis YBT-1518 | 1 (0.03%) | 3E-65 | 12-254 | 6-242 | 255 | 30 | 244 | ref|YP_005573819.1| | protein phosphatase 2C [Bacillus thuringiensis serovar chine... |
| 412694 | Bacillus thuringiensis str. Al Hakam | 1 (0.03%) | 4E-65 | 12-254 | 32-268 | 254 | 30 | 244 | ref|YP_896236.1| | protein phosphatase 2C [Bacillus thuringiensis str. Al Hakam... |
| 526992 | Bacillus cereus AH1271 | 1 (0.03%) | 4E-65 | 12-254 | 3-239 | 254 | 30 | 244 | ref|WP_002072834.1| | protein phosphatase [Bacillus cereus] gb|EEL80762.1| Protein... |
| 1053228 | Bacillus cereus VD102 | 1 (0.03%) | 3E-65 | 12-254 | 6-242 | 254 | 30 | 244 | ref|WP_000648697.1| | protein phosphatase [Bacillus cereus group] gb|EAL12189.1| S... |
| 288681 | Bacillus cereus E33L | 1 (0.03%) | 3E-65 | 12-254 | 6-242 | 254 | 30 | 244 | ref|YP_085204.1| | protein phosphatase 2C [Bacillus cereus E33L] ref|WP_0006486... |
| 1053194 | Bacillus cereus BAG6X1-1 | 1 (0.03%) | 3E-65 | 12-254 | 6-242 | 254 | 30 | 244 | ref|WP_000648695.1| | protein phosphatase [Bacillus cereus] gb|EJS71828.1| hypothe... |
| 526977 | Bacillus cereus ATCC 4342 | 1 (0.03%) | 3E-65 | 12-254 | 3-239 | 254 | 30 | 244 | ref|WP_002022154.1| | protein phosphatase [Bacillus cereus] gb|EEK82915.1| Protein... |
| 1053220 | Bacillus cereus MSX-A1 | 1 (0.03%) | 1E-64 | 12-254 | 6-242 | 253 | 30 | 244 | ref|YP_002447427.1| | protein phosphatase 2C, family protein [Bacillus cereus G984... |
| 1053185 | Bacillus cereus BAG4O-1 | 1 (0.03%) | 1E-64 | 12-254 | 6-242 | 253 | 30 | 244 | ref|WP_000648702.1| | protein phosphatase [Bacillus cereus] gb|EJQ12377.1| hypothe... |