old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 .
	MQAANDHFFTGLSKKGPVRKENQDFYGFSFNQNNLLIVVCDGLGGYKGGKIASNLVGKLFLSLFEGFEFNQWDETTVKKWFENTLIQARFQLENCFQTVYEAQIQFARMASTLVLGILTKSDIYIFWIGDSRAYLLFENQAKLVTKDHNLYNQLVAMNADEKLLLSYSNQLLALTNTISKETKRPLVYGFYNTKIEQQEFLLLCSDGLYNFVEKELFFEIITNSKNLKQAVFNLYRKSIENASNDNITAALVNLQKWKQS
tmhmm (0)	--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (5%)	------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXXXXX--------------------------------------------------------------------------------------
coiled-coils (0%)	--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (4%)	XX-----------------------------------------------------------------------X---------------------------XXX----------------------------------------------------------------------------------------------------------------------------------------------------X---XXXX
psipred	------EEEEEE--------------EE------EEEEEEE------HHHHHHHHHHHHHHHHHHHH------HHHHHHHHHHHHHHHHHHHHHHHHHHHHH---------EEEEEEEE--EEEEEE-----EEEEEEEEEEEEE----HHHHHHHHH----EEEE-----EEEEEE-----------EEEE------EEEEEE---------HHHHHHHHH----HHHHHHHHHHHHHH------EEEEEEEE------

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    21	    0.142
  max. Y     4	    0.146
  max. S     3	    0.273
  mean S     1-3    0.219
       D     1-3    0.175    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.175 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-260	alignment	5f1mA_301	1-254	0.8715	--

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
662947	Mycoplasma genitalium M2288	1 (0.03%)	4E-63	1-260	1-260	247	100	260	ref|NP_072770.1|	protein phosphatase 2C, [Mycoplasma genitalium G37] ref|YP_0...
2097	Mycoplasma genitalium	1 (0.03%)	1E-50	1-215	1-215	206	100	215	ref|WP_009885666.1|	protein phosphatase [Mycoplasma genitalium]
710128	Mycoplasma gallisepticum str. R(high)	1 (0.03%)	4E-44	5-256	1-260	184	34	261	ref|NP_853421.2|	PP2C-like serine/threonine protein phosphatase [Mycoplasma g...
708616	Mycoplasma gallisepticum str. F	1 (0.03%)	3E-44	5-256	1-260	184	34	261	ref|YP_005880955.1|	PP2C-like serine/threonine protein phosphatase [Mycoplasma g...
449659	Lactobacillus pobuzihii	1 (0.03%)	3E-61	9-260	3-247	241	31	254	ref|WP_017868032.1|	protein phosphatase [Lactobacillus pobuzihii]
243272	Mycoplasma arthritidis 158L3-1	1 (0.03%)	6E-48	7-254	1-247	197	31	252	ref|YP_002000181.1|	phosphoprotein serine/threonine phosphatase [Mycoplasma arth...
626096	Ureaplasma urealyticum serovar 2 str. ATCC 27814	1 (0.03%)	3E-41	9-249	3-242	175	31	245	ref|YP_002284613.1|	protein phosphatase [Ureaplasma urealyticum serovar 10 str. ...
1398	Bacillus coagulans	2 (0.05%)	4E-67	11-252	5-240	260	30	243	ref|WP_017552947.1|	protein phosphatase [Bacillus coagulans]
345219	Bacillus coagulans 36D1	1 (0.03%)	6E-67	11-252	5-240	260	30	243	ref|YP_004858109.1|	Ser/Thr phosphatase [Bacillus coagulans 36D1] ref|WP_0140954...
1053191	Bacillus cereus BAG5X2-1	1 (0.03%)	2E-65	12-254	6-242	255	30	244	ref|WP_000648694.1|	protein phosphatase [Bacillus cereus] gb|EEK66379.1| Protein...
1053176	Bacillus cereus BAG2O-1	1 (0.03%)	2E-65	12-254	6-242	255	30	244	ref|WP_016080515.1|	protein phosphatase 2C [Bacillus cereus] gb|EOO29204.1| prot...
529122	Bacillus thuringiensis YBT-1518	1 (0.03%)	3E-65	12-254	6-242	255	30	244	ref|YP_005573819.1|	protein phosphatase 2C [Bacillus thuringiensis serovar chine...
412694	Bacillus thuringiensis str. Al Hakam	1 (0.03%)	4E-65	12-254	32-268	254	30	244	ref|YP_896236.1|	protein phosphatase 2C [Bacillus thuringiensis str. Al Hakam...
526992	Bacillus cereus AH1271	1 (0.03%)	4E-65	12-254	3-239	254	30	244	ref|WP_002072834.1|	protein phosphatase [Bacillus cereus] gb|EEL80762.1| Protein...
1053228	Bacillus cereus VD102	1 (0.03%)	3E-65	12-254	6-242	254	30	244	ref|WP_000648697.1|	protein phosphatase [Bacillus cereus group] gb|EAL12189.1| S...
288681	Bacillus cereus E33L	1 (0.03%)	3E-65	12-254	6-242	254	30	244	ref|YP_085204.1|	protein phosphatase 2C [Bacillus cereus E33L] ref|WP_0006486...
1053194	Bacillus cereus BAG6X1-1	1 (0.03%)	3E-65	12-254	6-242	254	30	244	ref|WP_000648695.1|	protein phosphatase [Bacillus cereus] gb|EJS71828.1| hypothe...
526977	Bacillus cereus ATCC 4342	1 (0.03%)	3E-65	12-254	3-239	254	30	244	ref|WP_002022154.1|	protein phosphatase [Bacillus cereus] gb|EEK82915.1| Protein...
1053220	Bacillus cereus MSX-A1	1 (0.03%)	1E-64	12-254	6-242	253	30	244	ref|YP_002447427.1|	protein phosphatase 2C, family protein [Bacillus cereus G984...
1053185	Bacillus cereus BAG4O-1	1 (0.03%)	1E-64	12-254	6-242	253	30	244	ref|WP_000648702.1|	protein phosphatase [Bacillus cereus] gb|EJQ12377.1| hypothe...