old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280 . 290 . 300 . 310 . 320
	MRIANKFLVPKESENQRIDQFCLKILPLIKRSDFFKYLRLGKVLLNKTKPQVNTRLKTKDEIAFLFDINPYLQTNNDYLSLDLVKDKLKIIFEDENIIVVDKPTGIVCQPDKKHSIINLSNMLLKHCGYRQFDSNKLNFYPQFAHRIDRNTSGIVIGAKTNKALKELNKVFKNNHLTKRYKGLVFGQFNHLGLQTAYWKKDNNNGIVTVKWKPFPEAKKISTFFENSSYIAQKDMSLITIRLISGRTHQIRACLNLFSNQLVGDKKYSLIQFKNRNNKYKHQALHAYELVFPKLETSKFPILTNYSLMQFKSKIVPWFEYLIQ
tmhmm (0)	-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)	-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (4%)	XXXX--------------------------------------------------------------------------------------------------------------------------------XXX--------------------------------------------------------------------------XXXXX-------------------------------------------------------------------------------------------------------------
psipred	---EEEEEE-------HHHHHHHHH-----HHHHHHHHH---EEE--EE-----------EEEEE------------------------EEEE---EEEEE------EE---------HHHHHHHHHHH----------EEEEE--------EEEEEE--HHHHHHHHHHHHH----EEEEEEEE-------EEE--EEE-----EEEEEE------EEEEEEEEEEEE-----EEEEEEE-----HHHHHHHHHH--------------HHH--------HHHHH---EEE---------------EEEE---HHHHHHHH-
sam	----EEEEE-HHHHHHHHHHHHHHH-----HHHHHHHHHH--EEE---E----EEEE---EEEEEE-HHHHHH----------------EEEE---EEEEE----EEEE---------HHHHHHHHHHHH------------EEEE-------EEEEE--HHHHHHHHHHHHH---EEEEEEEEEEEE----EEEEEE-------EEEEEEE------EEEEEEEEEEEE----EEEEEEEEE--HHHHHHHHHHHH-------------HH-H----HHHHHHHHHHH------------H------EEE---HHHHHHHH-
jufo	-EEEEEEEEE----HHHHHHHHHHHH----HHHHHHHHHH-EEEEE-----------------------------------------HHHHHHHHHHHHHEE-----------------HHHHHHHH--HH-----------------------HHHHHHHHHHHHHHHHH-----------------------------------------------------------------HHEEEHHHHHHHHHHHHHHHHHHEEE------------------HHHHHHHHHH-----------------HHHHHHHHHHHHHHHH

# SignalP-4.0 gram- predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    55	    0.104
  max. Y    21	    0.105
  max. S    11	    0.137
  mean S     1-20   0.104
       D     1-20   0.104    0.570  NO
Name=tmp_signalp_seq	SP='NO' D=0.104 D-cutoff=0.570 Networks=SignalP-noTM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-74	alignment	5o5jD_308	1-200	0.764400	--
	75-323	alignment	5ubaA_307	1-261	0.871600	--

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
758678	Clostridium botulinum F str. 230613	2 (0.05%)	7E-92	1-323	1-298	343	29	324	ref|YP_001390824.1|	RluA family pseudouridine synthase [Clostridium botulinum F ...
212717	Clostridium tetani E88	1 (0.03%)	3E-91	1-323	1-300	341	29	325	ref|NP_782220.1|	ribosomal large subunit pseudouridine synthase D [Clostridiu...
1231072	Clostridium tetani 12124569	1 (0.03%)	2E-90	1-323	1-298	339	29	324	ref|YP_008773783.1|	ribosomal large subunit pseudouridine synthaseD [Clostridium...
86416	Clostridium pasteurianum BC1	1 (0.03%)	2E-90	7-322	6-297	338	29	317	ref|YP_007941396.1|	pseudouridine synthase, RluA family [Clostridium pasteurianu...
556270	Coprobacillus sp. D7	2 (0.05%)	4E-87	1-322	1-296	327	29	323	ref|WP_003536651.1|	RNA pseudouridine synthase [Erysipelotrichaceae] gb|EDS19344...
525327	Lactobacillus hilgardii ATCC 8290	1 (0.03%)	3E-86	3-323	1-293	325	29	322	ref|WP_003560449.1|	RNA pseudouridine synthase [Lactobacillus] gb|EEI18551.1| ps...
1232188	Clostridium botulinum CFSAN001628	2 (0.05%)	3E-85	7-323	6-298	321	29	318	ref|YP_001781114.1|	RluA family pseudouridine synthase [Clostridium botulinum B1...
908338	Peptoniphilus harei ACS-146-V-Sch2b	1 (0.03%)	4E-78	5-311	4-290	297	29	307	ref|WP_005956569.1|	ribosomal large subunit pseudouridine synthase D [Peptoniphi...
568206	Bacillus anthracis str. CDC 684	1 (0.03%)	8E-72	74-322	4-234	277	29	250	ref|YP_002813208.1|	ribosomal large subunit pseudouridine synthase, RluA family ...
445974	Clostridium ramosum DSM 1402	1 (0.03%)	8E-69	3-321	6-323	267	29	325	ref|WP_003538099.1|	hypothetical protein [[Clostridium] ramosum] gb|EDS17530.1| ...
1032505	Fusobacterium sp. OBRC1	1 (0.03%)	8E-47	4-279	1-266	193	29	280	ref|WP_005896777.1|	tRNA pseudouridine synthase A [Fusobacterium nucleatum] gb|E...
1053181	Bacillus cereus BAG2X1-3	1 (0.03%)	3E-98	1-322	1-297	365	28	323	ref|WP_000005844.1|	pseudouridine synthase [Bacillus cereus] gb|EJS71093.1| RluA...
1085388	Bacillus cereus BAG3O-1	1 (0.03%)	3E-98	1-322	1-297	364	28	323	ref|WP_016086567.1|	RluA family pseudouridine synthase [Bacillus cereus] gb|EOP1...
526968	Bacillus cereus R309803	1 (0.03%)	5E-98	1-322	1-297	364	28	323	ref|WP_000005845.1|	pseudouridine synthase [Bacillus cereus] gb|EEK77579.1| Unch...
1053249	Bacillus cereus VDM053	1 (0.03%)	1E-97	1-322	1-297	363	28	323	ref|WP_000005850.1|	pseudouridine synthase [Bacillus cereus] gb|EEL86501.1| Unch...
857293	Caloramator australicus RC3	1 (0.03%)	6E-98	1-323	1-299	363	28	324	ref|WP_008908669.1|	RNA pseudouridine synthase [Caloramator australicus] emb|CCJ...
1053177	Bacillus cereus BAG2O-2	1 (0.03%)	5E-97	1-322	1-297	361	28	323	ref|YP_006829936.1|	formamidase [Bacillus thuringiensis MC28] ref|YP_008781833.1...
526988	Bacillus cereus Rock4-18	1 (0.03%)	5E-97	1-322	1-297	361	28	323	ref|WP_000005849.1|	pseudouridine synthase [Bacillus cereus] gb|EEL59617.1| Unch...
526986	Bacillus cereus Rock3-44	3 (0.08%)	3E-97	1-322	1-297	361	28	323	ref|WP_000005852.1|	pseudouridine synthase [Bacillus cereus] gb|EEL49587.1| Unch...
1053194	Bacillus cereus BAG6X1-1	1 (0.03%)	3E-97	1-322	1-297	361	28	323	ref|WP_000005846.1|	pseudouridine synthase [Bacillus cereus] gb|EEK66218.1| Unch...