old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280 . 290 . 300 . 310 . 320 . 330 . 340 . 350 . 360 . 370 . 380 . 390 . 400 . 410 . 420 . 430 . 440 . 450 . 460 . 470 . 480 . 490 . 500 . 510 . 520 . 530 . 540 . 550 . 560 . 570 . 580
	MANNKSAIELKNIVVDFGESVAIDNINLSVEKHQLVSLLGPSGCGKTTTLAVIAGLIKPTSGQVLFNGYDVTKKPPQERKLGLVFQNYALYPHMNVFENIVFPLYSDNSWKQAVLEKNSVANHEINCLLLTSNGASVQEIDQLNKLFHDSIEKPKQIQYQINDLNVSVFKNLNELTANLKLIPSKHQFAITNLNKQTLKQINELEAEFKTKWKLQKQTPIKSGVEHNAKLQAIKQHFSYEKQRLKKHYFKTKVELKQTLVENLKLVKKAISEQTKLIKQSSDYTKLKQLKRLIKVEPNQLKKQYKVFLNQLIKNYSLKTDKLTDTQLNEIEQIKTRIVSIKQFINKTALEVANKLAITKILTKRPDKISGGQQQRVAIARAIVRRPKLLLMDEPLSNLDAKLRVQTRQWIRQFQQELQITTVFVTHDQEEAMSISDVIVCMSTGKVQQIGTPSELYLKPANEFVARFLGTPEMNIIECSVKNNQLFWNNHLLVTESFKLNVEKLLVGFRYEQLVVTTNKSSLQAKLINIENLGKHLVATISLFDTTLSMRLELNSHLKVGDSLNFIIKANNLHFFDIDTKQRIEI
tmhmm (0)	---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (2%)	-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXXXXXXXX--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (1%)	XXX----X------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------X
psipred	------EEEEEEEEEEE--EEEE---EEEE----EEEEE------HHHHHHHHH-------EEEEE--EE-----HHH--EEEEE----------HHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHH--EEEEE-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---------------HHHHH--EE----------EEEEEE--HHHH---------HHHHHHHH---------EEEE--EE------HH----EEEE---------HHHHHH------------HHHHHHHHHHHHHH---HHHH---HHH--HHHHHHHHHHHHHH----EEEE-----HHHHHHHHHHHHHHHHHHHHH--EEEEE---HHHHHHH--EEEEEE--EEEEE--HHHHHH----HHHH---------EEEEEEE--EEEE---------------EEEEEE-----EE------EEEEEEEEEE---EEEEEEEE--EEEEEEE----------EEEEEE-HHHEEEE------EE--

# SignalP-4.0 euk predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    63	    0.403
  max. Y    63	    0.200
  max. S     2	    0.137
  mean S     1-62   0.101
       D     1-62   0.147    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.147 D-cutoff=0.450 Networks=SignalP-noTM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-585	alignment	1v43A_202	1-353	0.5689	TRANSPORT PROTEIN

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
662947	Mycoplasma genitalium M2288	1 (0.03%)	1E-148	1-585	1-585	531	100	585	ref|NP_072850.1|	ABC transporter ATP-binding protein [Mycoplasma genitalium G...
662945	Mycoplasma genitalium M6320	1 (0.03%)	1E-148	1-585	1-585	530	100	585	ref|YP_006600714.1|	ABC transporter ATP-binding protein [Mycoplasma genitalium M...
662946	Mycoplasma genitalium M6282	1 (0.03%)	1E-147	1-585	1-585	527	100	585	ref|YP_006600211.1|	ABC transporter ATP-binding protein [Mycoplasma genitalium M...
1112856	Mycoplasma pneumoniae 309	1 (0.03%)	1E-126	4-585	9-583	460	59	585	ref|YP_005175371.1|	ABC transporter ATP-binding protein [Mycoplasma pneumoniae 3...
1238993	Mycoplasma pneumoniae M129-B7	1 (0.03%)	1E-126	4-585	9-583	460	59	585	ref|NP_109822.1|	sn-glycerol-3-phosphate transport system permease [Mycoplasm...
2107	Mycoplasma pulmonis	1 (0.03%)	1E-120	7-583	32-599	437	44	580	ref|NP_325857.1|	ABC transporter ATP-binding protein [Mycoplasma pulmonis UAB...
45361	Mycoplasma conjunctivae	1 (0.03%)	1E-117	3-583	29-603	428	43	584	ref|YP_002960539.1|	ABC transporter ATP-binding protein [Mycoplasma conjunctivae...
135742	Paracoccus methylutens	1 (0.03%)	8E-88	330-584	2-256	331	36	258	ref|YP_001429563.1|	putative ABC transporter ATP-binding protein [Paracoccus met...
680	Vibrio campbellii	1 (0.03%)	1E-119	259-584	29-354	435	35	329	ref|WP_010647273.1|	sn-glycerol-3-phosphate ABC transporter ATP-binding protein ...
314282	Psychromonas sp. CNPT3	1 (0.03%)	1E-108	259-585	29-355	398	35	330	ref|YP_007638875.1|	ABC transporter ATP-binding protein [Psychromonas sp. CNPT3]...
696485	Vibrio owensii	1 (0.03%)	1E-121	259-584	29-354	441	34	329	ref|WP_020194719.1|	sn-glycerol-3-phosphate ABC transporter ATP-binding protein ...
673519	Vibrio harveyi 1DA3	1 (0.03%)	1E-121	259-584	29-354	441	34	329	ref|WP_005439066.1|	sn-glycerol-3-phosphate ABC transporter ATP-binding protein ...
992012	Vibrio sp. HENC-03	1 (0.03%)	1E-120	259-584	29-354	440	34	329	ref|WP_009706248.1|	sn-glycerol-3-phosphate ABC transporter ATP-binding protein ...
410291	Vibrio campbellii HY01	4 (0.1%)	1E-120	259-584	29-354	439	34	329	ref|WP_005426419.1|	sn-glycerol-3-phosphate ABC transporter ATP-binding protein ...
338187	Vibrio campbellii ATCC BAA-1116	4 (0.1%)	1E-119	259-584	29-354	437	34	329	ref|YP_001448517.1|	hypothetical protein VIBHAR_06399 [Vibrio campbellii ATCC BA...
1224742	Vibrio campbellii CAIM 519 = NBRC 15631	1 (0.03%)	1E-119	259-584	29-354	436	34	329	ref|WP_005531915.1|	hypothetical protein [Vibrio campbellii] gb|ELU51980.1| hypo...
992011	Vibrio sp. HENC-02	1 (0.03%)	1E-119	259-584	29-354	435	34	329	gb|EKM32201.1|	ABC transporter family protein [Vibrio sp. HENC-02]
796620	Vibrio caribbenthicus ATCC BAA-2122	1 (0.03%)	1E-110	260-584	30-354	406	34	328	ref|WP_009601287.1|	sn-glycerol-3-phosphate ABC transporter ATP-binding protein ...
669	Vibrio harveyi	2 (0.05%)	1E-119	259-584	29-354	435	33	329	ref|WP_017818557.1|	sn-glycerol-3-phosphate ABC transporter ATP-binding protein ...
1125980	Vibrio harveyi CAIM 1792	1 (0.03%)	1E-118	259-584	29-354	434	33	329	ref|WP_005452646.1|	hypothetical protein [Vibrio harveyi] gb|EMR34319.1| hypothe...