old.robetta.org

A new Robetta server is available for structure prediction.

This service will be discontinued at the end of April 2026

     
Fragment Libraries    Alanine Scanning    DNA Interface Scan
[ Queue ] [ Submit ]    [ Queue ] [ Submit ]    [ Queue ] [ Submit ]
[ Register / Update ] [ Docs / FAQs ] [ Login ]


     
Job 88304 [SSGCID - MygeA.19934.c] [2019-01-18] [D-172-16-30-137.dhcp4.x.x] [Structure] [Complete] Putative esterase/lipase 3 (MG_344) - BATCH:88256

Full Structure Predictions  
Model 1

 chemical/x-pdb  MIME type  PDB file
Model 2

 chemical/x-pdb  MIME type  PDB file
Model 3

 chemical/x-pdb  MIME type  PDB file
Model 4

 chemical/x-pdb  MIME type  PDB file
Model 5

 chemical/x-pdb  MIME type  PDB file

Click the icons below each image to download the prediction in PDB format ( PDB file )

Images were produced using MolScript and Raster3D!




Plots powered by Plotly.js.

Features and Secondary Structure  
 
1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270 
 
MKRFSDLNQIDISKLEVFFQPAKKTKKQTVVFAHGFSVFHSYFQSFYKTLTDYDYYAPLWPGHNVNGFDYKELSPIHYGELLAAFIENKDLENIVLIGHSMGAAVCSYAMNLLNAKRVEKLILLAPLSYCNLLRYFKIKSSFKKDKAERMANFKAMFQTKFSNLTDENSWENELSKHSKMAKKLSNNILKELPVLNKTYKNLKLPVFLVLAQNDLFMPTKLTLSYFNKYLIKNNNLQSSVILNSEHQMFNSKYESFCKAMDDILNHNKLSKIY
tmhmm (0)
---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)
---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)
---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (2%)
X----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXX
psipred
--------EEEE--EEEEEEE-------EEEEE------HHHHHHHHHH-----EEEEE---------------HHHHHHHHHHHHHH-----EEEEEE-HHHHHHHHHHHHH-HHHEEEEEEE----------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHH----EEEEEE-------HHHHHHHHHHH-------EEEEE------HHHH-HHHHHHHHHHHH---------

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    25	    0.120
  max. Y    25	    0.159
  max. S    15	    0.228
  mean S     1-24   0.176
       D     1-24   0.166    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.166 D-cutoff=0.450 Networks=SignalP-TM


Domain Repeats Prediction     Top
  Boundary     STD (+/-)     Consensus  
------


Ginzu Domain Prediction 1       Top
Domain Span Source Reference Parent   Parent Span     Confidence     Annotations  
  1-273     alignment     4opmA_303     1-299   0.7381   --


PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA       Top
TaxID Species Alignments PSI-Blast Data (alignment with lowest E value)
E value Query Span Sbjct Span Bit Score Identity HSP Length Accession Description
662947Mycoplasma genitalium M22881 (0.03%)1E-581-2731-273233100273ref|NP_073014.1|alpha/beta fold family hydrolase [Mycoplasma genitalium G37]...
1238993Mycoplasma pneumoniae M129-B71 (0.03%)8E-511-2731-27220666273ref|NP_110207.1|triacylglycerol lipase 3 [Mycoplasma pneumoniae M129] ref|YP...
722438Mycoplasma pneumoniae FH1 (0.03%)2E-501-2731-27220566273ref|YP_005881518.1|hydrolase, alpha/beta domain protein [Mycoplasma pneumoniae ...
743965Mycoplasma putrefaciens KS11 (0.03%)2E-4230-26622-26517825248ref|YP_004790022.1|lipase/esterase family protein [Mycoplasma putrefaciens KS1]...
515609Ureaplasma parvum serovar 14 str. ATCC 336971 (0.03%)7E-3310-2664-27114725273ref|YP_001752101.1|triacylglycerol lipase [Ureaplasma parvum serovar 3 str. ATC...
754503Mycoplasma hyopneumoniae 74221 (0.03%)7E-4323-26722-27318024256ref|YP_008291561.1|lipase-esterase [Mycoplasma hyopneumoniae 7422] ref|WP_02083...
29562Mycoplasma ovipneumoniae1 (0.03%)3E-4526-26618-26518823252ref|WP_010321086.1|lipase [Mycoplasma ovipneumoniae]
866629Mycoplasma leachii 99/014/63 (0.08%)2E-441-2671-26318623276ref|YP_004047201.1|hypothetical protein MSB_A0456 [Mycoplasma leachii PG50] ref...
347257Mycoplasma agalactiae PG24 (0.1%)2E-4312-2664-26118223263ref|YP_001256147.1|esterase/lipase [Mycoplasma agalactiae PG2] ref|WP_011949186...
45361Mycoplasma conjunctivae1 (0.03%)7E-4124-26416-26017323250ref|YP_002961050.1|lipase/esterase [Mycoplasma conjunctivae HRC/581] ref|WP_012...
1237149Fulvivirga imtechensis AK71 (0.03%)5E-505-26416-29320422282ref|WP_009580895.1|hydrolase, alpha/beta fold family protein [Fulvivirga imtech...
1110504Mycoplasma agalactiae 146281 (0.03%)4E-4812-2665-26419822267ref|WP_004023897.1|alpha/beta hydrolase [Mycoplasma agalactiae] gb|EIN15432.1| ...
2110Mycoplasma agalactiae4 (0.1%)5E-4812-2665-26419722265ref|YP_003515695.1|Esterase/lipase [Mycoplasma agalactiae] ref|WP_013022116.1| ...
767465Mycoplasma bovis HB08012 (0.05%)1E-451-2661-26418922276ref|YP_004683568.1|esterase/lipase [Mycoplasma bovis Hubei-1] ref|YP_006471173....
289397Mycoplasma bovis PG453 (0.08%)3E-451-2661-26418822276ref|YP_004056170.1|alpha/beta hydrolase family protein [Mycoplasma bovis PG45] ...
766747synthetic Mycoplasma mycoides JCVI-syn1.04 (0.1%)6E-451-2671-26318722276gb|ACU78426.1|triacylglycerol lipase [Mycoplasma mycoides subsp. capri str...
862259Mycoplasma mycoides subsp. capri LC str. 950103 (0.08%)2E-441-2671-26318522276ref|YP_004400211.1|triacylglycerol lipase [Mycoplasma mycoides subsp. capri LC ...
1006581Mycoplasma gallisepticum S61 (0.03%)2E-391-2651-26816922274ref|YP_005880896.1|putative esterase/lipase [Mycoplasma gallisepticum str. F] r...
1265690Nafulsella turpanensis1 (0.03%)1E-5115-26838-31121021275ref|WP_017732101.1|hypothetical protein [Nafulsella turpanensis]
604354Thermococcus sibiricus MM 7391 (0.03%)2E-486-26637-30919921281ref|YP_002994854.1|carboxylesterase, alpha/beta hydrolase superfamily [Thermoco...






Robetta is available for NON-COMMERCIAL USE ONLY at this time
[ Terms of Service ]
Copyright © 2004-2011 University of Washington