| Features and Secondary Structure |
| | 1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 |
| | MKRFSDLNQIDISKLEVFFQPAKKTKKQTVVFAHGFSVFHSYFQSFYKTLTDYDYYAPLWPGHNVNGFDYKELSPIHYGELLAAFIENKDLENIVLIGHSMGAAVCSYAMNLLNAKRVEKLILLAPLSYCNLLRYFKIKSSFKKDKAERMANFKAMFQTKFSNLTDENSWENELSKHSKMAKKLSNNILKELPVLNKTYKNLKLPVFLVLAQNDLFMPTKLTLSYFNKYLIKNNNLQSSVILNSEHQMFNSKYESFCKAMDDILNHNKLSKIY |
| tmhmm (0) | --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| low complexity (0%) | --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| coiled-coils (0%) | --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| disordered (2%) | X----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXX |
| psipred | --------EEEE--EEEEEEE-------EEEEE------HHHHHHHHHH-----EEEEE---------------HHHHHHHHHHHHHH-----EEEEEE-HHHHHHHHHHHHH-HHHEEEEEEE----------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHH----EEEEEE-------HHHHHHHHHHH-------EEEEE------HHHH-HHHHHHHHHHHH--------- |
PSI-BLAST Sequence Hits (Top 20 by Identity) ALL DATA
|
| TaxID |
Species |
Alignments |
PSI-Blast Data (alignment with lowest E value) |
| E value |
Query Span |
Sbjct Span |
Bit Score |
Identity |
HSP Length |
Accession |
Description |
| 662947 | Mycoplasma genitalium M2288 | 1 (0.03%) | 1E-58 | 1-273 | 1-273 | 233 | 100 | 273 | ref|NP_073014.1| | alpha/beta fold family hydrolase [Mycoplasma genitalium G37]... |
| 1238993 | Mycoplasma pneumoniae M129-B7 | 1 (0.03%) | 8E-51 | 1-273 | 1-272 | 206 | 66 | 273 | ref|NP_110207.1| | triacylglycerol lipase 3 [Mycoplasma pneumoniae M129] ref|YP... |
| 722438 | Mycoplasma pneumoniae FH | 1 (0.03%) | 2E-50 | 1-273 | 1-272 | 205 | 66 | 273 | ref|YP_005881518.1| | hydrolase, alpha/beta domain protein [Mycoplasma pneumoniae ... |
| 743965 | Mycoplasma putrefaciens KS1 | 1 (0.03%) | 2E-42 | 30-266 | 22-265 | 178 | 25 | 248 | ref|YP_004790022.1| | lipase/esterase family protein [Mycoplasma putrefaciens KS1]... |
| 515609 | Ureaplasma parvum serovar 14 str. ATCC 33697 | 1 (0.03%) | 7E-33 | 10-266 | 4-271 | 147 | 25 | 273 | ref|YP_001752101.1| | triacylglycerol lipase [Ureaplasma parvum serovar 3 str. ATC... |
| 754503 | Mycoplasma hyopneumoniae 7422 | 1 (0.03%) | 7E-43 | 23-267 | 22-273 | 180 | 24 | 256 | ref|YP_008291561.1| | lipase-esterase [Mycoplasma hyopneumoniae 7422] ref|WP_02083... |
| 29562 | Mycoplasma ovipneumoniae | 1 (0.03%) | 3E-45 | 26-266 | 18-265 | 188 | 23 | 252 | ref|WP_010321086.1| | lipase [Mycoplasma ovipneumoniae] |
| 866629 | Mycoplasma leachii 99/014/6 | 3 (0.08%) | 2E-44 | 1-267 | 1-263 | 186 | 23 | 276 | ref|YP_004047201.1| | hypothetical protein MSB_A0456 [Mycoplasma leachii PG50] ref... |
| 347257 | Mycoplasma agalactiae PG2 | 4 (0.1%) | 2E-43 | 12-266 | 4-261 | 182 | 23 | 263 | ref|YP_001256147.1| | esterase/lipase [Mycoplasma agalactiae PG2] ref|WP_011949186... |
| 45361 | Mycoplasma conjunctivae | 1 (0.03%) | 7E-41 | 24-264 | 16-260 | 173 | 23 | 250 | ref|YP_002961050.1| | lipase/esterase [Mycoplasma conjunctivae HRC/581] ref|WP_012... |
| 1237149 | Fulvivirga imtechensis AK7 | 1 (0.03%) | 5E-50 | 5-264 | 16-293 | 204 | 22 | 282 | ref|WP_009580895.1| | hydrolase, alpha/beta fold family protein [Fulvivirga imtech... |
| 1110504 | Mycoplasma agalactiae 14628 | 1 (0.03%) | 4E-48 | 12-266 | 5-264 | 198 | 22 | 267 | ref|WP_004023897.1| | alpha/beta hydrolase [Mycoplasma agalactiae] gb|EIN15432.1| ... |
| 2110 | Mycoplasma agalactiae | 4 (0.1%) | 5E-48 | 12-266 | 5-264 | 197 | 22 | 265 | ref|YP_003515695.1| | Esterase/lipase [Mycoplasma agalactiae] ref|WP_013022116.1| ... |
| 767465 | Mycoplasma bovis HB0801 | 2 (0.05%) | 1E-45 | 1-266 | 1-264 | 189 | 22 | 276 | ref|YP_004683568.1| | esterase/lipase [Mycoplasma bovis Hubei-1] ref|YP_006471173.... |
| 289397 | Mycoplasma bovis PG45 | 3 (0.08%) | 3E-45 | 1-266 | 1-264 | 188 | 22 | 276 | ref|YP_004056170.1| | alpha/beta hydrolase family protein [Mycoplasma bovis PG45] ... |
| 766747 | synthetic Mycoplasma mycoides JCVI-syn1.0 | 4 (0.1%) | 6E-45 | 1-267 | 1-263 | 187 | 22 | 276 | gb|ACU78426.1| | triacylglycerol lipase [Mycoplasma mycoides subsp. capri str... |
| 862259 | Mycoplasma mycoides subsp. capri LC str. 95010 | 3 (0.08%) | 2E-44 | 1-267 | 1-263 | 185 | 22 | 276 | ref|YP_004400211.1| | triacylglycerol lipase [Mycoplasma mycoides subsp. capri LC ... |
| 1006581 | Mycoplasma gallisepticum S6 | 1 (0.03%) | 2E-39 | 1-265 | 1-268 | 169 | 22 | 274 | ref|YP_005880896.1| | putative esterase/lipase [Mycoplasma gallisepticum str. F] r... |
| 1265690 | Nafulsella turpanensis | 1 (0.03%) | 1E-51 | 15-268 | 38-311 | 210 | 21 | 275 | ref|WP_017732101.1| | hypothetical protein [Nafulsella turpanensis] |
| 604354 | Thermococcus sibiricus MM 739 | 1 (0.03%) | 2E-48 | 6-266 | 37-309 | 199 | 21 | 281 | ref|YP_002994854.1| | carboxylesterase, alpha/beta hydrolase superfamily [Thermoco... |