old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270
	MKRFSDLNQIDISKLEVFFQPAKKTKKQTVVFAHGFSVFHSYFQSFYKTLTDYDYYAPLWPGHNVNGFDYKELSPIHYGELLAAFIENKDLENIVLIGHSMGAAVCSYAMNLLNAKRVEKLILLAPLSYCNLLRYFKIKSSFKKDKAERMANFKAMFQTKFSNLTDENSWENELSKHSKMAKKLSNNILKELPVLNKTYKNLKLPVFLVLAQNDLFMPTKLTLSYFNKYLIKNNNLQSSVILNSEHQMFNSKYESFCKAMDDILNHNKLSKIY
tmhmm (0)	---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (0%)	---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
coiled-coils (0%)	---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (2%)	X----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------XXXX
psipred	--------EEEE--EEEEEEE-------EEEEE------HHHHHHHHHH-----EEEEE---------------HHHHHHHHHHHHHH-----EEEEEE-HHHHHHHHHHHHH-HHHEEEEEEE----------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHH----EEEEEE-------HHHHHHHHHHH-------EEEEE------HHHH-HHHHHHHHHHHH---------

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    25	    0.120
  max. Y    25	    0.159
  max. S    15	    0.228
  mean S     1-24   0.176
       D     1-24   0.166    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.166 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-273	alignment	4opmA_303	1-299	0.7381	--

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
662947	Mycoplasma genitalium M2288	1 (0.03%)	1E-58	1-273	1-273	233	100	273	ref|NP_073014.1|	alpha/beta fold family hydrolase [Mycoplasma genitalium G37]...
1238993	Mycoplasma pneumoniae M129-B7	1 (0.03%)	8E-51	1-273	1-272	206	66	273	ref|NP_110207.1|	triacylglycerol lipase 3 [Mycoplasma pneumoniae M129] ref|YP...
722438	Mycoplasma pneumoniae FH	1 (0.03%)	2E-50	1-273	1-272	205	66	273	ref|YP_005881518.1|	hydrolase, alpha/beta domain protein [Mycoplasma pneumoniae ...
743965	Mycoplasma putrefaciens KS1	1 (0.03%)	2E-42	30-266	22-265	178	25	248	ref|YP_004790022.1|	lipase/esterase family protein [Mycoplasma putrefaciens KS1]...
515609	Ureaplasma parvum serovar 14 str. ATCC 33697	1 (0.03%)	7E-33	10-266	4-271	147	25	273	ref|YP_001752101.1|	triacylglycerol lipase [Ureaplasma parvum serovar 3 str. ATC...
754503	Mycoplasma hyopneumoniae 7422	1 (0.03%)	7E-43	23-267	22-273	180	24	256	ref|YP_008291561.1|	lipase-esterase [Mycoplasma hyopneumoniae 7422] ref|WP_02083...
29562	Mycoplasma ovipneumoniae	1 (0.03%)	3E-45	26-266	18-265	188	23	252	ref|WP_010321086.1|	lipase [Mycoplasma ovipneumoniae]
866629	Mycoplasma leachii 99/014/6	3 (0.08%)	2E-44	1-267	1-263	186	23	276	ref|YP_004047201.1|	hypothetical protein MSB_A0456 [Mycoplasma leachii PG50] ref...
347257	Mycoplasma agalactiae PG2	4 (0.1%)	2E-43	12-266	4-261	182	23	263	ref|YP_001256147.1|	esterase/lipase [Mycoplasma agalactiae PG2] ref|WP_011949186...
45361	Mycoplasma conjunctivae	1 (0.03%)	7E-41	24-264	16-260	173	23	250	ref|YP_002961050.1|	lipase/esterase [Mycoplasma conjunctivae HRC/581] ref|WP_012...
1237149	Fulvivirga imtechensis AK7	1 (0.03%)	5E-50	5-264	16-293	204	22	282	ref|WP_009580895.1|	hydrolase, alpha/beta fold family protein [Fulvivirga imtech...
1110504	Mycoplasma agalactiae 14628	1 (0.03%)	4E-48	12-266	5-264	198	22	267	ref|WP_004023897.1|	alpha/beta hydrolase [Mycoplasma agalactiae] gb|EIN15432.1| ...
2110	Mycoplasma agalactiae	4 (0.1%)	5E-48	12-266	5-264	197	22	265	ref|YP_003515695.1|	Esterase/lipase [Mycoplasma agalactiae] ref|WP_013022116.1| ...
767465	Mycoplasma bovis HB0801	2 (0.05%)	1E-45	1-266	1-264	189	22	276	ref|YP_004683568.1|	esterase/lipase [Mycoplasma bovis Hubei-1] ref|YP_006471173....
289397	Mycoplasma bovis PG45	3 (0.08%)	3E-45	1-266	1-264	188	22	276	ref|YP_004056170.1|	alpha/beta hydrolase family protein [Mycoplasma bovis PG45] ...
766747	synthetic Mycoplasma mycoides JCVI-syn1.0	4 (0.1%)	6E-45	1-267	1-263	187	22	276	gb|ACU78426.1|	triacylglycerol lipase [Mycoplasma mycoides subsp. capri str...
862259	Mycoplasma mycoides subsp. capri LC str. 95010	3 (0.08%)	2E-44	1-267	1-263	185	22	276	ref|YP_004400211.1|	triacylglycerol lipase [Mycoplasma mycoides subsp. capri LC ...
1006581	Mycoplasma gallisepticum S6	1 (0.03%)	2E-39	1-265	1-268	169	22	274	ref|YP_005880896.1|	putative esterase/lipase [Mycoplasma gallisepticum str. F] r...
1265690	Nafulsella turpanensis	1 (0.03%)	1E-51	15-268	38-311	210	21	275	ref|WP_017732101.1|	hypothetical protein [Nafulsella turpanensis]
604354	Thermococcus sibiricus MM 739	1 (0.03%)	2E-48	6-266	37-309	199	21	281	ref|YP_002994854.1|	carboxylesterase, alpha/beta hydrolase superfamily [Thermoco...