| Features and Secondary Structure |
| | 1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280 . 290 . 300 . |
| | MNLYDLLELPTTASIKEIKIAYKRLAKRYHPDVNKLGSQTFVEINNAYSILSDPNQKEKYDSMLKVNDFQNRIKNLDISVRWHENFMEELELRKTWEFDFFSSDEDFFYSPFTKNKYASFLDKDVSLAFFQLYSKGKIDHQLEKSLLKRRDVKEACQQNKNFIEVIKEQYNYFGWIEAKRYFNINVELELTQREIRDRDVVNLPLKIKVINNDFPNQLWYEIYKNYSFRLSWDIKNGEIAEFFNKGNRALGWKGDLIVRMKVVNKVNKRLRIFSSFFENDKSKLWFLVPNDKQSNPNKGVFNYKTQHFID |
| tmhmm (0) | ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| low complexity (6%) | ------------------------------------------------------------------------------------------------XXXXXXXXXXXX--------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXX------------------------------------------ |
| coiled-coils (0%) | ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- |
| disordered (26%) | -------------------------------------------------------------------XXXXXXXXXXXXXXXXXX--------------XXXXXXXXXXXXXXXXXXXXXXXXXX--------------------------XXXXXXXXXXXXXXXXXXXXXXXXXXX--------------------------------------------------------------XXXXXXXXXX-----------------------------------------------------------X |
| psipred | ---HHH--------HHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHH--HHHHHHHHH-----------------------------------------------------------EEEEEEEHHHHH---EEEEE------------------------------------------EEEEEEE---------EEEEEEEEEE--------EEEEEEEEEEEEE--------EEEE-------------EEEEEEEE-------------EEE----EEEE-------------EE---HH--- |
PSI-BLAST Sequence Hits (Top 20 by Identity) ALL DATA
|
| TaxID |
Species |
Alignments |
PSI-Blast Data (alignment with lowest E value) |
| E value |
Query Span |
Sbjct Span |
Bit Score |
Identity |
HSP Length |
Accession |
Description |
| 662947 | Mycoplasma genitalium M2288 | 1 (0.03%) | 1E-74 | 1-310 | 1-310 | 286 | 100 | 310 | ref|NP_072662.2| | DnaJ domain-containing protein [Mycoplasma genitalium G37] r... |
| 10036 | Mesocricetus auratus | 1 (0.03%) | 1E-20 | 3-137 | 27-163 | 106 | 26 | 140 | gb|AAS45274.1| | microvascular endothelial differentiation gene 1 precursor [... |
| 7998 | Ictalurus punctatus | 1 (0.03%) | 7E-20 | 3-125 | 7-112 | 104 | 24 | 123 | gb|ABD65512.1| | DnaJ-like [Ictalurus punctatus] |
| 515618 | Candidatus Riesia pediculicola USDA | 1 (0.03%) | 2E-68 | 2-307 | 7-293 | 265 | 22 | 312 | ref|YP_003603393.1| | chaperone protein DnaJ [Candidatus Riesia pediculicola USDA]... |
| 5888 | Paramecium tetraurelia | 24 (0.6%) | 2E-59 | 2-284 | 25-298 | 235 | 22 | 293 | ref|XP_001427721.1| | hypothetical protein [Paramecium tetraurelia strain d4-2] em... |
| 265668 | Vibrio ponticus | 1 (0.03%) | 1E-30 | 10-182 | 1-170 | 140 | 22 | 185 | dbj|BAF62515.1| | DnaJ [Vibrio ponticus] |
| 658187 | Legionella drancourtii LLAP12 | 1 (0.03%) | 3E-77 | 2-307 | 5-289 | 295 | 21 | 313 | ref|WP_006869092.1| | molecular chaperone DnaJ [Legionella drancourtii] gb|EHL3286... |
| 1256991 | Providencia alcalifaciens PAL-1 | 1 (0.03%) | 1E-76 | 2-307 | 5-291 | 292 | 21 | 315 | gb|ETT01585.1| | chaperone protein DnaJ [Providencia alcalifaciens PAL-3] gb|... |
| 1141662 | Providencia burhodogranariea DSM 19968 | 1 (0.03%) | 6E-76 | 2-307 | 5-290 | 290 | 21 | 314 | ref|WP_008913298.1| | chaperone protein DnaJ [Providencia burhodogranariea] gb|EKT... |
| 463 | Fluoribacter dumoffii | 1 (0.03%) | 2E-75 | 2-307 | 5-290 | 289 | 21 | 312 | ref|WP_010654428.1| | molecular chaperone DnaJ [Fluoribacter dumoffii] |
| 434271 | Actinobacillus pleuropneumoniae serovar 3 str. JL03 | 1 (0.03%) | 3E-73 | 2-307 | 5-291 | 282 | 21 | 311 | ref|YP_001652944.1| | chaperone protein DnaJ [Actinobacillus pleuropneumoniae sero... |
| 1095749 | Pasteurella bettyae CCUG 2042 | 1 (0.03%) | 2E-73 | 2-307 | 5-286 | 282 | 21 | 311 | ref|WP_005758777.1| | molecular chaperone DnaJ [Pasteurella bettyae] gb|EIJ71353.1... |
| 754255 | Actinobacillus pleuropneumoniae serovar 4 str. M62 | 1 (0.03%) | 5E-73 | 2-307 | 20-307 | 281 | 21 | 311 | ref|WP_005605996.1| | molecular chaperone DnaJ [Actinobacillus pleuropneumoniae] g... |
| 416269 | Actinobacillus pleuropneumoniae serovar 5b str. L20 | 1 (0.03%) | 3E-73 | 2-307 | 5-291 | 281 | 21 | 311 | ref|YP_001054590.1| | chaperone protein DnaJ [Actinobacillus pleuropneumoniae sero... |
| 754259 | Actinobacillus pleuropneumoniae serovar 10 str. D13039 | 1 (0.03%) | 6E-73 | 2-307 | 20-306 | 281 | 21 | 311 | ref|WP_005613458.1| | molecular chaperone DnaJ [Actinobacillus pleuropneumoniae] g... |
| 1227358 | Bacillus weihenstephanensis FSL H7-687 | 1 (0.03%) | 5E-72 | 2-307 | 5-288 | 277 | 21 | 312 | ref|WP_002129144.1| | molecular chaperone DnaJ [Bacillus cereus group] gb|EEL97639... |
| 717 | Actinobacillus capsulatus | 1 (0.03%) | 1E-71 | 2-307 | 5-291 | 276 | 21 | 311 | ref|WP_018650695.1| | molecular chaperone DnaJ [Actinobacillus capsulatus] |
| 71421 | Haemophilus influenzae Rd KW20 | 1 (0.03%) | 6E-71 | 2-307 | 17-301 | 274 | 21 | 311 | ref|NP_439394.1| | chaperone protein DnaJ [Haemophilus influenzae Rd KW20] ref|... |
| 656912 | Haemophilus influenzae RdAW | 1 (0.03%) | 5E-71 | 2-307 | 18-302 | 274 | 21 | 311 | ref|WP_005694298.1| | molecular chaperone DnaJ [Haemophilus influenzae] gb|EEW7612... |
| 696748 | Actinobacillus suis H91-0380 | 1 (0.03%) | 7E-71 | 2-307 | 5-291 | 273 | 21 | 311 | ref|YP_006817986.1| | chaperone protein DnaJ [Actinobacillus suis H91-0380] ref|WP... |