old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 . 210 . 220 . 230 . 240 . 250 . 260 . 270 . 280 . 290 . 300 .
	MNLYDLLELPTTASIKEIKIAYKRLAKRYHPDVNKLGSQTFVEINNAYSILSDPNQKEKYDSMLKVNDFQNRIKNLDISVRWHENFMEELELRKTWEFDFFSSDEDFFYSPFTKNKYASFLDKDVSLAFFQLYSKGKIDHQLEKSLLKRRDVKEACQQNKNFIEVIKEQYNYFGWIEAKRYFNINVELELTQREIRDRDVVNLPLKIKVINNDFPNQLWYEIYKNYSFRLSWDIKNGEIAEFFNKGNRALGWKGDLIVRMKVVNKVNKRLRIFSSFFENDKSKLWFLVPNDKQSNPNKGVFNYKTQHFID
tmhmm (0)	----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (6%)	------------------------------------------------------------------------------------------------XXXXXXXXXXXX--------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXX------------------------------------------
coiled-coils (0%)	----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (26%)	-------------------------------------------------------------------XXXXXXXXXXXXXXXXXX--------------XXXXXXXXXXXXXXXXXXXXXXXXXX--------------------------XXXXXXXXXXXXXXXXXXXXXXXXXXX--------------------------------------------------------------XXXXXXXXXX-----------------------------------------------------------X
psipred	---HHH--------HHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHH--HHHHHHHHH-----------------------------------------------------------EEEEEEEHHHHH---EEEEE------------------------------------------EEEEEEE---------EEEEEEEEEE--------EEEEEEEEEEEEE--------EEEE-------------EEEEEEEE-------------EEE----EEEE-------------EE---HH---

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    61	    0.113
  max. Y    16	    0.133
  max. S    13	    0.190
  mean S     1-15   0.158
       D     1-15   0.143    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.143 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-310	alignment	4j80A_301	1-271	0.975400	--

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
662947	Mycoplasma genitalium M2288	1 (0.03%)	1E-74	1-310	1-310	286	100	310	ref|NP_072662.2|	DnaJ domain-containing protein [Mycoplasma genitalium G37] r...
10036	Mesocricetus auratus	1 (0.03%)	1E-20	3-137	27-163	106	26	140	gb|AAS45274.1|	microvascular endothelial differentiation gene 1 precursor [...
7998	Ictalurus punctatus	1 (0.03%)	7E-20	3-125	7-112	104	24	123	gb|ABD65512.1|	DnaJ-like [Ictalurus punctatus]
515618	Candidatus Riesia pediculicola USDA	1 (0.03%)	2E-68	2-307	7-293	265	22	312	ref|YP_003603393.1|	chaperone protein DnaJ [Candidatus Riesia pediculicola USDA]...
5888	Paramecium tetraurelia	24 (0.6%)	2E-59	2-284	25-298	235	22	293	ref|XP_001427721.1|	hypothetical protein [Paramecium tetraurelia strain d4-2] em...
265668	Vibrio ponticus	1 (0.03%)	1E-30	10-182	1-170	140	22	185	dbj|BAF62515.1|	DnaJ [Vibrio ponticus]
658187	Legionella drancourtii LLAP12	1 (0.03%)	3E-77	2-307	5-289	295	21	313	ref|WP_006869092.1|	molecular chaperone DnaJ [Legionella drancourtii] gb|EHL3286...
1256991	Providencia alcalifaciens PAL-1	1 (0.03%)	1E-76	2-307	5-291	292	21	315	gb|ETT01585.1|	chaperone protein DnaJ [Providencia alcalifaciens PAL-3] gb|...
1141662	Providencia burhodogranariea DSM 19968	1 (0.03%)	6E-76	2-307	5-290	290	21	314	ref|WP_008913298.1|	chaperone protein DnaJ [Providencia burhodogranariea] gb|EKT...
463	Fluoribacter dumoffii	1 (0.03%)	2E-75	2-307	5-290	289	21	312	ref|WP_010654428.1|	molecular chaperone DnaJ [Fluoribacter dumoffii]
434271	Actinobacillus pleuropneumoniae serovar 3 str. JL03	1 (0.03%)	3E-73	2-307	5-291	282	21	311	ref|YP_001652944.1|	chaperone protein DnaJ [Actinobacillus pleuropneumoniae sero...
1095749	Pasteurella bettyae CCUG 2042	1 (0.03%)	2E-73	2-307	5-286	282	21	311	ref|WP_005758777.1|	molecular chaperone DnaJ [Pasteurella bettyae] gb|EIJ71353.1...
754255	Actinobacillus pleuropneumoniae serovar 4 str. M62	1 (0.03%)	5E-73	2-307	20-307	281	21	311	ref|WP_005605996.1|	molecular chaperone DnaJ [Actinobacillus pleuropneumoniae] g...
416269	Actinobacillus pleuropneumoniae serovar 5b str. L20	1 (0.03%)	3E-73	2-307	5-291	281	21	311	ref|YP_001054590.1|	chaperone protein DnaJ [Actinobacillus pleuropneumoniae sero...
754259	Actinobacillus pleuropneumoniae serovar 10 str. D13039	1 (0.03%)	6E-73	2-307	20-306	281	21	311	ref|WP_005613458.1|	molecular chaperone DnaJ [Actinobacillus pleuropneumoniae] g...
1227358	Bacillus weihenstephanensis FSL H7-687	1 (0.03%)	5E-72	2-307	5-288	277	21	312	ref|WP_002129144.1|	molecular chaperone DnaJ [Bacillus cereus group] gb|EEL97639...
717	Actinobacillus capsulatus	1 (0.03%)	1E-71	2-307	5-291	276	21	311	ref|WP_018650695.1|	molecular chaperone DnaJ [Actinobacillus capsulatus]
71421	Haemophilus influenzae Rd KW20	1 (0.03%)	6E-71	2-307	17-301	274	21	311	ref|NP_439394.1|	chaperone protein DnaJ [Haemophilus influenzae Rd KW20] ref|...
656912	Haemophilus influenzae RdAW	1 (0.03%)	5E-71	2-307	18-302	274	21	311	ref|WP_005694298.1|	molecular chaperone DnaJ [Haemophilus influenzae] gb|EEW7612...
696748	Actinobacillus suis H91-0380	1 (0.03%)	7E-71	2-307	5-291	273	21	311	ref|YP_006817986.1|	chaperone protein DnaJ [Actinobacillus suis H91-0380] ref|WP...