old.robetta.org

A new Robetta server is available for structure prediction.

This service will be discontinued at the end of April 2026

     
Fragment Libraries    Alanine Scanning    DNA Interface Scan
[ Queue ] [ Submit ]    [ Queue ] [ Submit ]    [ Queue ] [ Submit ]
[ Register / Update ] [ Docs / FAQs ] [ Login ]


     
Job 88320 [SSGCID - MygeA.19956.a] [2019-01-18] [D-172-16-30-137.dhcp4.x.x] [Structure] [Complete] DnaJ-like protein MG002 (MG_002) - BATCH:88256

Full Structure Predictions  
Model 1

 chemical/x-pdb  MIME type  PDB file
Model 2

 chemical/x-pdb  MIME type  PDB file
Model 3

 chemical/x-pdb  MIME type  PDB file
Model 4

 chemical/x-pdb  MIME type  PDB file
Model 5

 chemical/x-pdb  MIME type  PDB file

Click the icons below each image to download the prediction in PDB format ( PDB file )

Images were produced using MolScript and Raster3D!




Plots powered by Plotly.js.

Features and Secondary Structure  
 
1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  
 
MNLYDLLELPTTASIKEIKIAYKRLAKRYHPDVNKLGSQTFVEINNAYSILSDPNQKEKYDSMLKVNDFQNRIKNLDISVRWHENFMEELELRKTWEFDFFSSDEDFFYSPFTKNKYASFLDKDVSLAFFQLYSKGKIDHQLEKSLLKRRDVKEACQQNKNFIEVIKEQYNYFGWIEAKRYFNINVELELTQREIRDRDVVNLPLKIKVINNDFPNQLWYEIYKNYSFRLSWDIKNGEIAEFFNKGNRALGWKGDLIVRMKVVNKVNKRLRIFSSFFENDKSKLWFLVPNDKQSNPNKGVFNYKTQHFID
tmhmm (0)
----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
low complexity (6%)
------------------------------------------------------------------------------------------------XXXXXXXXXXXX--------------------------------------------------------------------------------------------------------------------------------------------------------XXXXXXXX------------------------------------------
coiled-coils (0%)
----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
disordered (26%)
-------------------------------------------------------------------XXXXXXXXXXXXXXXXXX--------------XXXXXXXXXXXXXXXXXXXXXXXXXX--------------------------XXXXXXXXXXXXXXXXXXXXXXXXXXX--------------------------------------------------------------XXXXXXXXXX-----------------------------------------------------------X
psipred
---HHH--------HHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHH--HHHHHHHHH-----------------------------------------------------------EEEEEEEHHHHH---EEEEE------------------------------------------EEEEEEE---------EEEEEEEEEE--------EEEEEEEEEEEEE--------EEEE-------------EEEEEEEE-------------EEE----EEEE-------------EE---HH---

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    61	    0.113
  max. Y    16	    0.133
  max. S    13	    0.190
  mean S     1-15   0.158
       D     1-15   0.143    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.143 D-cutoff=0.450 Networks=SignalP-TM


Domain Repeats Prediction     Top
  Boundary     STD (+/-)     Consensus  
------


Ginzu Domain Prediction 1       Top
Domain Span Source Reference Parent   Parent Span     Confidence     Annotations  
  1-310     alignment     4j80A_301     1-271   0.975400   --


PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA       Top
TaxID Species Alignments PSI-Blast Data (alignment with lowest E value)
E value Query Span Sbjct Span Bit Score Identity HSP Length Accession Description
662947Mycoplasma genitalium M22881 (0.03%)1E-741-3101-310286100310ref|NP_072662.2|DnaJ domain-containing protein [Mycoplasma genitalium G37] r...
10036Mesocricetus auratus1 (0.03%)1E-203-13727-16310626140gb|AAS45274.1|microvascular endothelial differentiation gene 1 precursor [...
7998Ictalurus punctatus1 (0.03%)7E-203-1257-11210424123gb|ABD65512.1|DnaJ-like [Ictalurus punctatus]
515618Candidatus Riesia pediculicola USDA1 (0.03%)2E-682-3077-29326522312ref|YP_003603393.1|chaperone protein DnaJ [Candidatus Riesia pediculicola USDA]...
5888Paramecium tetraurelia24 (0.6%)2E-592-28425-29823522293ref|XP_001427721.1|hypothetical protein [Paramecium tetraurelia strain d4-2] em...
265668Vibrio ponticus1 (0.03%)1E-3010-1821-17014022185dbj|BAF62515.1|DnaJ [Vibrio ponticus]
658187Legionella drancourtii LLAP121 (0.03%)3E-772-3075-28929521313ref|WP_006869092.1|molecular chaperone DnaJ [Legionella drancourtii] gb|EHL3286...
1256991Providencia alcalifaciens PAL-11 (0.03%)1E-762-3075-29129221315gb|ETT01585.1|chaperone protein DnaJ [Providencia alcalifaciens PAL-3] gb|...
1141662Providencia burhodogranariea DSM 199681 (0.03%)6E-762-3075-29029021314ref|WP_008913298.1|chaperone protein DnaJ [Providencia burhodogranariea] gb|EKT...
463Fluoribacter dumoffii1 (0.03%)2E-752-3075-29028921312ref|WP_010654428.1|molecular chaperone DnaJ [Fluoribacter dumoffii]
434271Actinobacillus pleuropneumoniae serovar 3 str. JL031 (0.03%)3E-732-3075-29128221311ref|YP_001652944.1|chaperone protein DnaJ [Actinobacillus pleuropneumoniae sero...
1095749Pasteurella bettyae CCUG 20421 (0.03%)2E-732-3075-28628221311ref|WP_005758777.1|molecular chaperone DnaJ [Pasteurella bettyae] gb|EIJ71353.1...
754255Actinobacillus pleuropneumoniae serovar 4 str. M621 (0.03%)5E-732-30720-30728121311ref|WP_005605996.1|molecular chaperone DnaJ [Actinobacillus pleuropneumoniae] g...
416269Actinobacillus pleuropneumoniae serovar 5b str. L201 (0.03%)3E-732-3075-29128121311ref|YP_001054590.1|chaperone protein DnaJ [Actinobacillus pleuropneumoniae sero...
754259Actinobacillus pleuropneumoniae serovar 10 str. D130391 (0.03%)6E-732-30720-30628121311ref|WP_005613458.1|molecular chaperone DnaJ [Actinobacillus pleuropneumoniae] g...
1227358Bacillus weihenstephanensis FSL H7-6871 (0.03%)5E-722-3075-28827721312ref|WP_002129144.1|molecular chaperone DnaJ [Bacillus cereus group] gb|EEL97639...
717Actinobacillus capsulatus1 (0.03%)1E-712-3075-29127621311ref|WP_018650695.1|molecular chaperone DnaJ [Actinobacillus capsulatus]
71421Haemophilus influenzae Rd KW201 (0.03%)6E-712-30717-30127421311ref|NP_439394.1|chaperone protein DnaJ [Haemophilus influenzae Rd KW20] ref|...
656912Haemophilus influenzae RdAW1 (0.03%)5E-712-30718-30227421311ref|WP_005694298.1|molecular chaperone DnaJ [Haemophilus influenzae] gb|EEW7612...
696748Actinobacillus suis H91-03801 (0.03%)7E-712-3075-29127321311ref|YP_006817986.1|chaperone protein DnaJ [Actinobacillus suis H91-0380] ref|WP...






Robetta is available for NON-COMMERCIAL USE ONLY at this time
[ Terms of Service ]
Copyright © 2004-2011 University of Washington