old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 .
	MLNSRFPVSVKKSHSLRERKVFTTILQSKTRFFGTFINAYFIKNNHSTWRVAISIAKTKYKLAVQRNLIKRQIRSIFQQISNNLEPWDILVIVNKGFIELTFKEKQKLFLQLLKRIKEVDAYQTSANK
tmhmm (0)	--------------------------------------------------------------------------------------------------------------------------------
low complexity (13%)	--------------------------------------------------------------------------------------------------XXXXXXXXXXXXXXXX--------------
coiled-coils (0%)	--------------------------------------------------------------------------------------------------------------------------------
disordered (19%)	XXXXXXXXXXX--------------------------------------------------------------------------------------------------------XXXXXXXXXXXXX
psipred	-----------HHH----HHHHHHHHH---EEE---EEEEEE-------EEEEEEE--------HHHHHHHHHHHHHHHHHHH----EEEEEE--------HHHHHHHHHHHHHHHHHH---------

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    40	    0.124
  max. Y    13	    0.252
  max. S     7	    0.722
  mean S     1-12   0.607
       D     1-12   0.391    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.391 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-128	alignment	2ljpA_202	1-119	0.8568	HYDROLASE

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
488339	synthetic Mycoplasma genitalium JCVI-1.0	1 (0.04%)	3E-24	1-128	1-128	116	100	128	ref|NP_073135.1|	ribonuclease P protein component [Mycoplasma genitalium G37]...
662947	Mycoplasma genitalium M2288	1 (0.04%)	3E-22	8-128	1-121	110	99	121	ref|YP_006600011.1|	ribonuclease P protein component [Mycoplasma genitalium M232...
1001585	Pseudomonas mendocina NK-01	1 (0.04%)	6E-16	55-118	2-65	89	45	64	ref|YP_004382740.1|	ribonuclease P, partial [Pseudomonas mendocina NK-01] ref|WP...
388919	Streptococcus sanguinis SK36	1 (0.04%)	4E-18	42-118	2-77	97	35	77	ref|YP_001036057.1|	ribonuclease P protein component [Streptococcus sanguinis SK...
1069628	Streptococcus pneumoniae GA08825	1 (0.04%)	3E-17	38-128	1-91	94	35	92	ref|WP_001842744.1|	ribonuclease P [Streptococcus pneumoniae] gb|EIA04083.1| rib...
1131630	Streptococcus pneumoniae GA62331	1 (0.04%)	2E-17	38-128	1-91	94	35	92	ref|WP_001859630.1|	ribonuclease P [Streptococcus pneumoniae] gb|EJH15086.1| rib...
760750	Streptococcus pneumoniae GA06083	1 (0.04%)	5E-17	38-128	1-91	93	35	92	ref|WP_001841218.1|	ribonuclease P [Streptococcus pneumoniae] gb|EHZ07958.1| rib...
1161416	Streptococcus sp. SR1	1 (0.04%)	8E-28	10-128	1-119	128	34	120	gb|EUC79504.1|	ribonuclease P protein component [Streptococcus sp. SR1]
996285	Pseudomonas stutzeri DSM 4166	1 (0.04%)	1E-24	34-127	3-96	118	34	94	ref|YP_005940965.1|	ribonuclease P [Pseudomonas stutzeri DSM 4166] ref|WP_014598...
675812	Grimontia hollisae CIP 101886	1 (0.04%)	9E-12	56-123	2-69	75	34	68	ref|WP_005500792.1|	ribonuclease P [Grimontia hollisae] gb|EEY74192.1| ribonucle...
1048830	Mycoplasma iowae 695	1 (0.04%)	1E-11	16-117	2-103	75	34	102	ref|WP_004024633.1|	ribonuclease P protein component [Mycoplasma iowae] gb|EGZ31...
936580	Streptococcus sp. CM6	1 (0.04%)	1E-28	10-128	1-119	131	33	120	ref|WP_000748118.1|	ribonuclease P [Streptococcus oralis] gb|EGV02852.1| ribonuc...
1282664	Streptococcus tigurinus AZ_3a	1 (0.04%)	4E-28	10-128	1-119	130	33	120	ref|YP_004325221.1|	ribonuclease P [Streptococcus oralis Uo5] ref|WP_000748120.1...
862971	Streptococcus anginosus C238	1 (0.04%)	5E-28	10-117	1-107	129	33	108	ref|YP_008501586.1|	ribonuclease P [Streptococcus anginosus C238] ref|WP_0030264...
28037	Streptococcus mitis	1 (0.04%)	9E-27	10-128	1-119	125	33	120	ref|WP_023947950.1|	ribonuclease P [Streptococcus mitis] gb|ETD97741.1| ribonucl...
718251	Edwardsiella tarda FL6-60	1 (0.04%)	2E-15	44-115	2-73	88	33	72	ref|YP_003297594.1|	RNase P protein component, partial [Edwardsiella tarda EIB20...
998088	Aeromonas veronii B565	1 (0.04%)	1E-11	56-118	2-64	75	33	63	ref|YP_004394677.1|	ribonuclease P protein component, partial [Aeromonas veronii...
360104	Campylobacter concisus 13826	1 (0.04%)	3E-4	61-109	2-50	50	33	49	ref|YP_001466645.1|	hypothetical protein CCC13826_1621 [Campylobacter concisus 1...
699248	Streptococcus ratti FA-1 = DSM 20564	1 (0.04%)	8E-31	10-128	1-118	138	32	119	ref|WP_003089566.1|	ribonuclease P [Streptococcus ratti] gb|EJN94506.1| ribonucl...
1076934	Streptococcus lutetiensis 033	1 (0.04%)	3E-30	10-128	1-118	136	32	119	ref|YP_008357143.1|	ribonuclease P [Streptococcus lutetiensis 033] ref|WP_020917...