old.robetta.org

Click the icons below each image to download the prediction in PDB format ( )

Features and Secondary Structure
	1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100
	MLNCVFLEGEIESTKWSHKKTGFLVTIKQKRLFGERSFTDFFVFYANGQLAFELEAYTQKFKTISIEGILRTYLEKRSGIWKTTIEVVKIMKPNSKVMIDYQES
tmhmm (0)	--------------------------------------------------------------------------------------------------------
low complexity (0%)	--------------------------------------------------------------------------------------------------------
coiled-coils (0%)	--------------------------------------------------------------------------------------------------------
disordered (3%)	X-----------------------------------------------------------------------------------------------------XX
psipred	---EEEEE-EEHHH-------EEEEEEEHHHHH------EEEEEEE--EEHHHHHHHHHH-EEEEEEEHHHHHHHHH----EEEEEEEEE-----EEEEE----

# SignalP-4.0 gram+ predictions
# Measure  Position  Value  Cutoff  signal peptide?
  max. C    20	    0.151
  max. Y    20	    0.161
  max. S    11	    0.213
  mean S     1-19   0.160
       D     1-19   0.161    0.450  NO
Name=tmp_signalp_seq	SP='NO' D=0.161 D-cutoff=0.450 Networks=SignalP-TM

Domain Repeats Prediction
Boundary	STD (+/-)	Consensus
--	--	--

Ginzu Domain Prediction 1
Domain	Span	Source	Reference Parent	Parent Span	Confidence	Annotations
	1-104	alignment	2hqlA_201	1-104	1.0000	DNA BINDING PROTEIN

PSI-BLAST Sequence Hits (Top 20 by Identity)   ALL DATA
TaxID	Species	Alignments	PSI-Blast Data (alignment with lowest E value)
			E value	Query Span	Sbjct Span	Bit Score	Identity	HSP Length	Accession	Description
662945	Mycoplasma genitalium M6320	1 (16.67%)	1E-38	1-104	1-104	164	100	104	ref|NP_073048.1|	hypothetical protein MG_376 [Mycoplasma genitalium G37] ref|...
662947	Mycoplasma genitalium M2288	1 (16.67%)	1E-34	7-104	1-98	151	99	98	ref|YP_006601422.1|	hypothetical protein CM5_02230 [Mycoplasma genitalium M2288]...
0	UNIDENTIFIED	1 (16.67%)	3E-35	1-103	7-109	153	74	103	pdb|2HQL|A	Chain A, Crystal Structure Of A Small Single-Stranded Dna Bi...
1238993	Mycoplasma pneumoniae M129-B7	1 (16.67%)	3E-35	1-103	1-103	153	74	103	ref|NP_110243.1|	hypothetical protein MPN554 [Mycoplasma pneumoniae M129] ref...
1006581	Mycoplasma gallisepticum S6	1 (16.67%)	3E-27	1-91	1-91	127	55	91	ref|YP_005880466.1|	single-stranded DNA binding protein [Mycoplasma gallisepticu...
1159204	Mycoplasma gallisepticum NC08_2008.031-4-3P	1 (16.67%)	3E-27	1-91	1-91	126	54	91	ref|NP_852956.2|	single-stranded DNA binding protein [Mycoplasma gallisepticu...