| Features and Secondary Structure |
| | 1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 |
| | MLNCVFLEGEIESTKWSHKKTGFLVTIKQKRLFGERSFTDFFVFYANGQLAFELEAYTQKFKTISIEGILRTYLEKRSGIWKTTIEVVKIMKPNSKVMIDYQES |
| tmhmm (0) | -------------------------------------------------------------------------------------------------------- |
| low complexity (0%) | -------------------------------------------------------------------------------------------------------- |
| coiled-coils (0%) | -------------------------------------------------------------------------------------------------------- |
| disordered (3%) | X-----------------------------------------------------------------------------------------------------XX |
| psipred | ---EEEEE-EEHHH-------EEEEEEEHHHHH------EEEEEEE--EEHHHHHHHHHH-EEEEEEEHHHHHHHHH----EEEEEEEEE-----EEEEE---- |
PSI-BLAST Sequence Hits (Top 20 by Identity) ALL DATA
|
| TaxID |
Species |
Alignments |
PSI-Blast Data (alignment with lowest E value) |
| E value |
Query Span |
Sbjct Span |
Bit Score |
Identity |
HSP Length |
Accession |
Description |
| 662945 | Mycoplasma genitalium M6320 | 1 (16.67%) | 1E-38 | 1-104 | 1-104 | 164 | 100 | 104 | ref|NP_073048.1| | hypothetical protein MG_376 [Mycoplasma genitalium G37] ref|... |
| 662947 | Mycoplasma genitalium M2288 | 1 (16.67%) | 1E-34 | 7-104 | 1-98 | 151 | 99 | 98 | ref|YP_006601422.1| | hypothetical protein CM5_02230 [Mycoplasma genitalium M2288]... |
| 0 | UNIDENTIFIED | 1 (16.67%) | 3E-35 | 1-103 | 7-109 | 153 | 74 | 103 | pdb|2HQL|A | Chain A, Crystal Structure Of A Small Single-Stranded Dna Bi... |
| 1238993 | Mycoplasma pneumoniae M129-B7 | 1 (16.67%) | 3E-35 | 1-103 | 1-103 | 153 | 74 | 103 | ref|NP_110243.1| | hypothetical protein MPN554 [Mycoplasma pneumoniae M129] ref... |
| 1006581 | Mycoplasma gallisepticum S6 | 1 (16.67%) | 3E-27 | 1-91 | 1-91 | 127 | 55 | 91 | ref|YP_005880466.1| | single-stranded DNA binding protein [Mycoplasma gallisepticu... |
| 1159204 | Mycoplasma gallisepticum NC08_2008.031-4-3P | 1 (16.67%) | 3E-27 | 1-91 | 1-91 | 126 | 54 | 91 | ref|NP_852956.2| | single-stranded DNA binding protein [Mycoplasma gallisepticu... |